Search Antibody, Protein, and ELISA Kit Solutions

CCDC90A Antibody - middle region (ARP44777_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44777_P050-FITC Conjugated

ARP44777_P050-HRP Conjugated

ARP44777_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
The immunogen is a synthetic peptide directed towards the middle region of human CCDC90A
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rat: 93%
Complete computational species homology data:
Anti-CCDC90A (ARP44777_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MCUR1 (ARP44777_P050) antibody is Catalog # AAP44777 (Previous Catalog # AAPP34340)
Printable datasheet for anti-MCUR1 (ARP44777_P050) antibody
Target Reference:
Mallilankaraman K, Cárdenas C, Doonan PJ, Chandramoorthy HC, Irrinki KM, Golenár T, Csordás G, Madireddi P, Yang J, Muller M, Miller R, Kolesar JE, Molgo J, Kaufman B, Hajnoczky G, Foskett JK and Madesh M. 2012. MCUR1 is an Essential Component of Mitochondrial Ca2+ Uptake that Regulates Cellular Metabolism. Nature Cell Biol 14:1336-43
Calcium: Helping Ca2+ into mitochondria, Nature Rev Mol Cell Biol. 2012 14(4):4

Mallilankaraman, K. et al. MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. Nat. Cell Biol. 14, 1336-43 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 23178883

Shanmughapriya, S; Rajan, S; Hoffman, NE; Zhang, X; Guo, S; Kolesar, JE; Hines, KJ; Ragheb, J; Jog, NR; Caricchio, R; Baba, Y; Zhou, Y; Kaufman, BA; Cheung, JY; Kurosaki, T; Gill, DL; Madesh, M; Ca2+ signals regulate mitochondrial metabolism by stimulating CREB-mediated expression of the mitochondrial Ca2+ uniporter gene MCU. 8, ra23 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 25737585

Gene Symbol:
Official Gene Full Name:
Coiled-coil domain containing 90A
Alias Symbols:
C6orf79, FLJ20958, CCDC90A
NCBI Gene Id:
Protein Name:
Coiled-coil domain-containing protein 90A, mitochondrial
Description of Target:
Essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCDC90A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCDC90A.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...