Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44777_P050-FITC Conjugated

ARP44777_P050-HRP Conjugated

ARP44777_P050-Biotin Conjugated

CCDC90A Antibody - middle region (ARP44777_P050)

Catalog#: ARP44777_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CCDC90A
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rat: 93%
Complete computational species homology data Anti-CCDC90A (ARP44777_P050)
Peptide Sequence Synthetic peptide located within the following region: ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MCUR1 (ARP44777_P050) antibody is Catalog # AAP44777 (Previous Catalog # AAPP34340)
Datasheets/Manuals Printable datasheet for anti-MCUR1 (ARP44777_P050) antibody
Target Reference Mallilankaraman K, Cárdenas C, Doonan PJ, Chandramoorthy HC, Irrinki KM, Golenár T, Csordás G, Madireddi P, Yang J, Muller M, Miller R, Kolesar JE, Molgo J, Kaufman B, Hajnoczky G, Foskett JK and Madesh M. 2012. MCUR1 is an Essential Component of Mitochondrial Ca2+ Uptake that Regulates Cellular Metabolism. Nature Cell Biol 14:1336-43
Calcium: Helping Ca2+ into mitochondria, Nature Rev Mol Cell Biol. 2012 14(4):4

Mallilankaraman, K. et al. MCUR1 is an essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism. Nat. Cell Biol. 14, 1336-43 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 23178883

Shanmughapriya, S; Rajan, S; Hoffman, NE; Zhang, X; Guo, S; Kolesar, JE; Hines, KJ; Ragheb, J; Jog, NR; Caricchio, R; Baba, Y; Zhou, Y; Kaufman, BA; Cheung, JY; Kurosaki, T; Gill, DL; Madesh, M; Ca2+ signals regulate mitochondrial metabolism by stimulating CREB-mediated expression of the mitochondrial Ca2+ uniporter gene MCU. 8, ra23 (2015). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 25737585

Gene Symbol MCUR1
Official Gene Full Name Coiled-coil domain containing 90A
Alias Symbols C6orf79, FLJ20958, CCDC90A
NCBI Gene Id 63933
Protein Name Coiled-coil domain-containing protein 90A, mitochondrial
Description of Target Essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism.
Swissprot Id Q96AQ8
Protein Accession # NP_001026883
Nucleotide Accession # NM_001031713
Protein Size (# AA) 359
Molecular Weight 40kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CCDC90A.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CCDC90A.
  1. What is the species homology for "CCDC90A Antibody - middle region (ARP44777_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat".

  2. How long will it take to receive "CCDC90A Antibody - middle region (ARP44777_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CCDC90A Antibody - middle region (ARP44777_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "CCDC90A Antibody - middle region (ARP44777_P050)"?

    This target may also be called "C6orf79, FLJ20958, CCDC90A" in publications.

  5. What is the shipping cost for "CCDC90A Antibody - middle region (ARP44777_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CCDC90A Antibody - middle region (ARP44777_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CCDC90A Antibody - middle region (ARP44777_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CCDC90A Antibody - middle region (ARP44777_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MCUR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MCUR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MCUR1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MCUR1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MCUR1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MCUR1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CCDC90A Antibody - middle region (ARP44777_P050)
Your Rating