Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP30002_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30002_P050-FITC Conjugated

ARP30002_P050-HRP Conjugated

ARP30002_P050-Biotin Conjugated

CBX4 Antibody - N-terminal region (ARP30002_P050)

Catalog#: ARP30002_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-19299, HPA008228
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CBX4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Complete computational species homology dataAnti-CBX4 (ARP30002_P050)
Peptide SequenceSynthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CBX4 (ARP30002_P050) antibody is Catalog # AAP30002 (Previous Catalog # AAPH00102)
Datasheets/ManualsPrintable datasheet for anti-CBX4 (ARP30002_P050) antibody
Sample Type Confirmation

CBX4 is supported by BioGPS gene expression data to be expressed in Jurkat

Target ReferenceKagey,M.H., et al., (2003) Cell 113 (1), 127-137
Publications

Hao, L., Midic, U., Garriga, J. & Latham, K. E. Contribution of CBX4 to cumulus oophorus cell phenotype in mice and attendant effects in cumulus cell cloned embryos. Physiol. Genomics 46, 66-80 (2014). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 24280258

Gene SymbolCBX4
Official Gene Full NameChromobox homolog 4
Alias SymbolsPC2, NBP16
NCBI Gene Id8535
Protein NameE3 SUMO-protein ligase CBX4
Description of TargetThe polycomb group (PcG) protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins. Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.
Swissprot IdO00257-2
Protein Accession #NP_003646
Nucleotide Accession #NM_003655
Protein Size (# AA)560
Molecular Weight61kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CBX4.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CBX4.
Protein InteractionsRnf111; SUMO1; NEDD8; CBS; BMI1; EED; RNF2; HECW2; SOX2; YWHAE; YWHAB; CCDC158; DIS3L2; HIST4H4; CBX2; PARP12; RNF213; ZKSCAN7; DCAF6; KDM3A; MYCBP2; ANKRD26; PSME3; TRANK1; CBX4; HIST1H2AB; YWHAZ; SKIL; NPM1; HIST1H2BB; GTF2I; PHC2; CSNK2B; CSNK2A2; CSNK
Write Your Own Review
You're reviewing:CBX4 Antibody - N-terminal region (ARP30002_P050)
Your Rating
Aviva Travel Grant
Aviva Tips and Tricks
Aviva Tissue Tool
Aviva ChIP Antibodies