Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP30002_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30002_P050-FITC Conjugated

ARP30002_P050-HRP Conjugated

ARP30002_P050-Biotin Conjugated

CBX4 Antibody - N-terminal region (ARP30002_P050)

Catalog#: ARP30002_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-19299, HPA008228
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CBX4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data Anti-CBX4 (ARP30002_P050)
Peptide Sequence Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CBX4 (ARP30002_P050) antibody is Catalog # AAP30002 (Previous Catalog # AAPH00102)
Datasheets/Manuals Printable datasheet for anti-CBX4 (ARP30002_P050) antibody
Sample Type Confirmation

CBX4 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Kagey,M.H., et al., (2003) Cell 113 (1), 127-137
Publications

Hao, L., Midic, U., Garriga, J. & Latham, K. E. Contribution of CBX4 to cumulus oophorus cell phenotype in mice and attendant effects in cumulus cell cloned embryos. Physiol. Genomics 46, 66-80 (2014). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 24280258

Gene Symbol CBX4
Official Gene Full Name Chromobox homolog 4
Alias Symbols PC2, NBP16
NCBI Gene Id 8535
Protein Name E3 SUMO-protein ligase CBX4
Description of Target The polycomb group (PcG) protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins. Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.
Swissprot Id O00257-2
Protein Accession # NP_003646
Nucleotide Accession # NM_003655
Protein Size (# AA) 560
Molecular Weight 61kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CBX4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CBX4.
Protein Interactions Rnf111; SUMO1; NEDD8; CBS; BMI1; EED; RNF2; HECW2; SOX2; YWHAE; YWHAB; CCDC158; DIS3L2; HIST4H4; CBX2; PARP12; RNF213; ZKSCAN7; DCAF6; KDM3A; MYCBP2; ANKRD26; PSME3; TRANK1; CBX4; HIST1H2AB; YWHAZ; SKIL; NPM1; HIST1H2BB; GTF2I; PHC2; CSNK2B; CSNK2A2; CSNK
  1. What is the species homology for "CBX4 Antibody - N-terminal region (ARP30002_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "CBX4 Antibody - N-terminal region (ARP30002_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CBX4 Antibody - N-terminal region (ARP30002_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CBX4 Antibody - N-terminal region (ARP30002_P050)"?

    This target may also be called "PC2, NBP16" in publications.

  5. What is the shipping cost for "CBX4 Antibody - N-terminal region (ARP30002_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CBX4 Antibody - N-terminal region (ARP30002_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CBX4 Antibody - N-terminal region (ARP30002_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "61kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CBX4 Antibody - N-terminal region (ARP30002_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CBX4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CBX4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CBX4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CBX4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CBX4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CBX4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CBX4 Antibody - N-terminal region (ARP30002_P050)
Your Rating
We found other products you might like!