Search Antibody, Protein, and ELISA Kit Solutions

CBX4 Antibody - N-terminal region (ARP30002_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30002_P050-FITC Conjugated

ARP30002_P050-HRP Conjugated

ARP30002_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
CBX4
Official Gene Full Name:
Chromobox homolog 4
NCBI Gene Id:
8535
Protein Name:
E3 SUMO-protein ligase CBX4
Swissprot Id:
O00257-2
Protein Accession #:
NP_003646
Nucleotide Accession #:
NM_003655
Alias Symbols:
PC2, NBP16
Replacement Item:
This antibody may replace item sc-19299, HPA008228
Description of Target:
The polycomb group (PcG) protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins. Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.
Protein Size (# AA):
560
Molecular Weight:
61kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CBX4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CBX4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CBX4
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-CBX4 (ARP30002_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Rnf111; SUMO1; NEDD8; CBS; BMI1; EED; RNF2; HECW2; SOX2; YWHAE; YWHAB; CCDC158; DIS3L2; HIST4H4; CBX2; PARP12; RNF213; ZKSCAN7; DCAF6; KDM3A; MYCBP2; ANKRD26; PSME3; TRANK1; CBX4; HIST1H2AB; YWHAZ; SKIL; NPM1; HIST1H2BB; GTF2I; PHC2; CSNK2B; CSNK2A2; CSNK
Blocking Peptide:
For anti-CBX4 (ARP30002_P050) antibody is Catalog # AAP30002 (Previous Catalog # AAPH00102)
Datasheets/Manuals:
Printable datasheet for anti-CBX4 (ARP30002_P050) antibody
Sample Type Confirmation:

CBX4 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Kagey,M.H., et al., (2003) Cell 113 (1), 127-137
Publications:

Hao, L., Midic, U., Garriga, J. & Latham, K. E. Contribution of CBX4 to cumulus oophorus cell phenotype in mice and attendant effects in cumulus cell cloned embryos. Physiol. Genomics 46, 66-80 (2014). IHC, WB, Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish 24280258

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...