CBS Recombinant Protein (Mouse) (OPCA03532)

Catalog No: OPCA03532

Cbs Recombinant Protein (Mouse) (OPCA03532) in SDS-PAGE showing the molecular weight of approximately 63.41 kDa.

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Lyophilized 10mM Tris-HCl, 1mM EDTA, 6% Trehalose
• Host: Mouse
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: Full Length of Mature Protein: PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT
• Source: Yeast
• Protein Range: 2-561 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: A tissue-specific atlas of mouse protein phosphorylation and expression.Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.Cell 143:1174-1189(2010)
• Gene Symbol: Cbs
• Gene Full Name: cystathionine beta-synthase
• Alias Symbols: AI047524;AI303044;beta-thionase;cystathionine beta-synthase;HI;HIP4;serine sulfhydrase.
• NCBI Gene Id: 12411
• Protein Name: Cystathionine beta-synthase
• Description of Target: Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine (By similarity). Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons (By similarity).
• Uniprot ID: Q91WT9
• Protein Accession #: NP_001258282.1
  
• Nucleotide Accession #: NM_001271353.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 65 kDa