SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP45746_T100-HRP
Size:100ul
Price: $384.00
SKU
ARP45746_T100-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CBS Antibody - N-terminal region : HRP (ARP45746_T100-HRP)

Datasheets/ManualsPrintable datasheet for anti-CBS (ARP45746_T100-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationIHC, WB
Additional InformationIHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CBS
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
Concentration0.5 mg/ml
Blocking PeptideFor anti-CBS (ARP45746_T100-HRP) antibody is Catalog # AAP45746 (Previous Catalog # AAPP26703)
ReferenceUrreizti,R., (2006) J. Hum. Genet. 51 (4), 305-313
Publications

Fernandes, V. S. et al. Endogenous hydrogen sulfide has a powerful role in inhibitory neurotransmission to the pig bladder neck. J. Urol. 189, 1567-73 (2013). IHC, Bovine, Human, Dog, Horse, Rabbit, Rat, Guinea pig, Mouse, Zebrafish, Yeast 23063804

Markand, S. et al. Cystathionine beta synthase expression in mouse retina. Curr. Eye Res. 38, 597-604 (2013). IHC, Bovine, Human, Dog, Horse, Rabbit, Rat, Guinea pig, Mouse, Zebrafish, Yeast 23470016

Dahlhoff, C. et al. Hepatic methionine homeostasis is conserved in C57BL/6N mice on high-fat diet despite major changes in hepatic one-carbon metabolism. PLoS One 8, e57387 (2013). WB, Bovine, Human, Dog, Horse, Rabbit, Rat, Guinea pig, Mouse, Zebrafish, Yeast 23472083

Geillinger, K. E. et al. Hepatic metabolite profiles in mice with a suboptimal selenium status. J. Nutr. Biochem. 25, 914-22 (2014). WB, Bovine, Human, Dog, Horse, Rabbit, Rat, Guinea pig, Mouse, Zebrafish, Yeast 24917045

Yamane, S., Kanno, T., Nakamura, H., Fujino, H. & Murayama, T. Hydrogen sulfide-mediated regulation of contractility in the mouse ileum with electrical stimulation: Roles of l-cysteine, cystathionine β-synthase, and K(+) channels. Eur. J. Pharmacol. 740, 112-20 (2014). WB, Bovine, Human, Dog, Horse, Rabbit, Rat, Guinea pig, Mouse, Zebrafish, Yeast 25008073

Dahlhoff, C. et al. Methyl-donor supplementation in obese mice prevents the progression of NAFLD, activates AMPK and decreases acyl-carnitine levels. Mol. Metab. 3, 565-80 (2014). WB, Bovine, Human, Dog, Horse, Rabbit, Rat, Guinea pig, Mouse, Zebrafish, Yeast 25061561

Porteus, C. S. et al. The role of hydrogen sulphide in the control of breathing in hypoxic zebrafish (Danio rerio). J. Physiol. 592, 3075-88 (2014). IHC, Bovine, Human, Dog, Horse, Rabbit, Rat, Guinea pig, Mouse, Zebrafish, Yeast 24756639

Gene SymbolCBS
Gene Full NameCystathionine-beta-synthase
Alias SymbolsCBSL, HIP4
NCBI Gene Id875
Protein NameCystathionine beta-synthase
Description of TargetCBS is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.The protein encoded by this gene is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.
Uniprot IDP35520
Protein Accession #NP_000062
Nucleotide Accession #NM_000071
Protein Size (# AA)551
Molecular Weight60kDa
Protein InteractionsUBASH3A; UBE2I; PSMA1; PRKAG1; PIN1; EHHADH; CBS; SUMO1; UBC; NEDD8; PIAS3; RANBP9; PIAS1; CBX4; SRP14; RAD23B; PKM; NUCB1; IREB2; HSF1; LRSAM1; C14orf142; UBA5; IPO4; GOPC; PARP6; NPLOC4; DERA; ERO1L; DBNL; GPN1; PDLIM5; PLIN3; UBA2; GPSM1; COL4A3BP; UGP
  1. What is the species homology for "CBS Antibody - N-terminal region : HRP (ARP45746_T100-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "CBS Antibody - N-terminal region : HRP (ARP45746_T100-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CBS Antibody - N-terminal region : HRP (ARP45746_T100-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CBS Antibody - N-terminal region : HRP (ARP45746_T100-HRP)"?

    This target may also be called "CBSL, HIP4" in publications.

  5. What is the shipping cost for "CBS Antibody - N-terminal region : HRP (ARP45746_T100-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CBS Antibody - N-terminal region : HRP (ARP45746_T100-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CBS Antibody - N-terminal region : HRP (ARP45746_T100-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CBS Antibody - N-terminal region : HRP (ARP45746_T100-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CBS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CBS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CBS"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CBS"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CBS"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CBS"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CBS Antibody - N-terminal region : HRP (ARP45746_T100-HRP)
Your Rating
We found other products you might like!