Search Antibody, Protein, and ELISA Kit Solutions

CBS Antibody - N-terminal region (ARP45746_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45746_T100-FITC Conjugated

ARP45746_T100-HRP Conjugated

ARP45746_T100-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse, Rat
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Protein Name:
Cystathionine beta-synthase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-111129 from Santa Cruz Biotechnology.
Description of Target:
CBS is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.The protein encoded by this gene is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CBS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CBS.
The immunogen is a synthetic peptide directed towards the N terminal region of human CBS
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 93%
Complete computational species homology data:
Anti-CBS (ARP45746_T100)
Peptide Sequence:
Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CBS (ARP45746_T100) antibody is Catalog # AAP45746 (Previous Catalog # AAPP26703)
Printable datasheet for anti-CBS (ARP45746_T100) antibody
Target Reference:
Urreizti,R., (2006) J. Hum. Genet. 51 (4), 305-313

Dahlhoff, C. et al. Hepatic methionine homeostasis is conserved in C57BL/6N mice on high-fat diet despite major changes in hepatic one-carbon metabolism. PLoS One 8, e57387 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23472083

Dahlhoff, C. et al. Methyl-donor supplementation in obese mice prevents the progression of NAFLD, activates AMPK and decreases acyl-carnitine levels. Mol. Metab. 3, 565-80 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 25061561

Fernandes, V. S. et al. Endogenous hydrogen sulfide has a powerful role in inhibitory neurotransmission to the pig bladder neck. J. Urol. 189, 1567-73 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23063804

Geillinger, K. E. et al. Hepatic metabolite profiles in mice with a suboptimal selenium status. J. Nutr. Biochem. 25, 914-22 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 24917045

Markand, S. et al. Cystathionine beta synthase expression in mouse retina. Curr. Eye Res. 38, 597-604 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23470016

Porteus, C. S. et al. The role of hydrogen sulphide in the control of breathing in hypoxic zebrafish (Danio rerio). J. Physiol. 592, 3075-88 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 24756639

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23103828

Yamane, S., Kanno, T., Nakamura, H., Fujino, H. & Murayama, T. Hydrogen sulfide-mediated regulation of contractility in the mouse ileum with electrical stimulation: Roles of l-cysteine, cystathionine b-synthase, and K(+) channels. Eur. J. Pharmacol. 740, 112-20 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 25008073

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...