Size:100 ul
$249.00
In Stock
SKU
ARP45746_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45746_T100-FITC Conjugated

ARP45746_T100-HRP Conjugated

ARP45746_T100-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse, Rat
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-111129 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CBS
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 93%
Complete computational species homology data Anti-CBS (ARP45746_T100)
Peptide Sequence Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CBS (ARP45746_T100) antibody is Catalog # AAP45746 (Previous Catalog # AAPP26703)
Datasheets/Manuals Printable datasheet for anti-CBS (ARP45746_T100) antibody
Target Reference Urreizti,R., (2006) J. Hum. Genet. 51 (4), 305-313
Publications

Dahlhoff, C. et al. Hepatic methionine homeostasis is conserved in C57BL/6N mice on high-fat diet despite major changes in hepatic one-carbon metabolism. PLoS One 8, e57387 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23472083

Dahlhoff, C. et al. Methyl-donor supplementation in obese mice prevents the progression of NAFLD, activates AMPK and decreases acyl-carnitine levels. Mol. Metab. 3, 565-80 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 25061561

Fernandes, V. S. et al. Endogenous hydrogen sulfide has a powerful role in inhibitory neurotransmission to the pig bladder neck. J. Urol. 189, 1567-73 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23063804

Geillinger, K. E. et al. Hepatic metabolite profiles in mice with a suboptimal selenium status. J. Nutr. Biochem. 25, 914-22 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 24917045

Markand, S. et al. Cystathionine beta synthase expression in mouse retina. Curr. Eye Res. 38, 597-604 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23470016

Porteus, C. S. et al. The role of hydrogen sulphide in the control of breathing in hypoxic zebrafish (Danio rerio). J. Physiol. 592, 3075-88 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 24756639

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 23103828

Yamane, S., Kanno, T., Nakamura, H., Fujino, H. & Murayama, T. Hydrogen sulfide-mediated regulation of contractility in the mouse ileum with electrical stimulation: Roles of l-cysteine, cystathionine b-synthase, and K(+) channels. Eur. J. Pharmacol. 740, 112-20 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 25008073

Gene Symbol CBS
Official Gene Full Name Cystathionine-beta-synthase
Alias Symbols HIP4
NCBI Gene Id 875
Protein Name Cystathionine beta-synthase
Description of Target CBS is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.The protein encoded by this gene is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.
Swissprot Id P35520
Protein Accession # NP_000062
Nucleotide Accession # NM_000071
Protein Size (# AA) 551
Molecular Weight 60kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CBS.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CBS.
Protein Interactions UBASH3A; UBE2I; PSMA1; PRKAG1; PIN1; EHHADH; CBS; SUMO1; UBC; NEDD8; PIAS3; RANBP9; PIAS1; CBX4; SRP14; RAD23B; PKM; NUCB1; IREB2; HSF1; LRSAM1; C14orf142; UBA5; IPO4; GOPC; PARP6; NPLOC4; DERA; ERO1L; DBNL; GPN1; PDLIM5; PLIN3; UBA2; GPSM1; COL4A3BP; UGP
  1. What is the species homology for "CBS Antibody - N-terminal region (ARP45746_T100)"?

    The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish".

  2. How long will it take to receive "CBS Antibody - N-terminal region (ARP45746_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CBS Antibody - N-terminal region (ARP45746_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CBS Antibody - N-terminal region (ARP45746_T100)"?

    This target may also be called "HIP4" in publications.

  5. What is the shipping cost for "CBS Antibody - N-terminal region (ARP45746_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CBS Antibody - N-terminal region (ARP45746_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CBS Antibody - N-terminal region (ARP45746_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CBS Antibody - N-terminal region (ARP45746_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CBS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CBS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CBS"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CBS"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CBS"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CBS"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CBS Antibody - N-terminal region (ARP45746_T100)
Your Rating