Search Antibody, Protein, and ELISA Kit Solutions

CBR1 antibody - middle region (ARP45800_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45800_P050-FITC Conjugated

ARP45800_P050-HRP Conjugated

ARP45800_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Carbonyl reductase 1
Protein Name:
Carbonyl reductase [NADPH] 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CBR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CBR1.
The immunogen is a synthetic peptide directed towards the middle region of human CBR1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 79%; Rat: 93%; Zebrafish: 79%
Complete computational species homology data:
Anti-CBR1 (ARP45800_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MDM2; GRB2; VHL; ESR1; UBC; COPS5; CUL1; UL27; RAD21; Mapk13; UBA5; DDA1; ATG101; PRKAB1; EGFR; ERCC8; MCC;
Blocking Peptide:
For anti-CBR1 (ARP45800_P050) antibody is Catalog # AAP45800 (Previous Catalog # AAPP26744)
Printable datasheet for anti-CBR1 (ARP45800_P050) antibody
Sample Type Confirmation:

CBR1 is supported by BioGPS gene expression data to be expressed in OVCAR3


Lim, S. et al. Carbonyl reductase 1 is an essential regulator of skeletal muscle differentiation and regeneration. Int. J. Biochem. Cell Biol. 45, 1784-93 (2013). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23732109

Mitani, T. et al. Resveratrol reduces the hypoxia-induced resistance to doxorubicin in breast cancer cells. J. Nutr. Sci. Vitaminol. (Tokyo). 60, 122-8 (2014). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 24975222

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...