Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP45800_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45800_P050-FITC Conjugated

ARP45800_P050-HRP Conjugated

ARP45800_P050-Biotin Conjugated

CBR1 Antibody - middle region (ARP45800_P050)

Catalog#: ARP45800_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CBR1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 79%; Rat: 93%; Zebrafish: 79%
Complete computational species homology data Anti-CBR1 (ARP45800_P050)
Peptide Sequence Synthetic peptide located within the following region: AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CBR1 (ARP45800_P050) antibody is Catalog # AAP45800 (Previous Catalog # AAPP26744)
Datasheets/Manuals Printable datasheet for anti-CBR1 (ARP45800_P050) antibody
Sample Type Confirmation

CBR1 is supported by BioGPS gene expression data to be expressed in OVCAR3

Publications

Lim, S. et al. Carbonyl reductase 1 is an essential regulator of skeletal muscle differentiation and regeneration. Int. J. Biochem. Cell Biol. 45, 1784-93 (2013). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23732109

Mitani, T. et al. Resveratrol reduces the hypoxia-induced resistance to doxorubicin in breast cancer cells. J. Nutr. Sci. Vitaminol. (Tokyo). 60, 122-8 (2014). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 24975222

Gene Symbol CBR1
Official Gene Full Name Carbonyl reductase 1
Alias Symbols CBR, hCBR1, SDR21C1
NCBI Gene Id 873
Protein Name Carbonyl reductase [NADPH] 1
Description of Target Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.
Swissprot Id P16152
Protein Accession # NP_001748
Nucleotide Accession # NM_001757
Protein Size (# AA) 277
Molecular Weight 30kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CBR1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CBR1.
Protein Interactions MDM2; GRB2; VHL; ESR1; UBC; COPS5; CUL1; UL27; RAD21; Mapk13; UBA5; DDA1; ATG101; PRKAB1; EGFR; ERCC8; MCC;
Write Your Own Review
You're reviewing:CBR1 Antibody - middle region (ARP45800_P050)
Your Rating