CBLN4 Antibody - C-terminal region (ARP52505_P050)

Catalog No: ARP52505_P050

WB Suggested Anti-CBLN4 Antibody Titration: 1 ug/ml
Positive Control: Hela cell lysate

Immunohistochemistry with Human, cortex tissue at an antibody concentration of 5.0ug/ml using anti-CBLN4 antibody (ARP52505_P050)

Human cortex

Product Info

• Publications:

  Glycosylation of Cblns attenuates their receptor binding. Brain Res. 1694, 129-139 (2018) 29782851

  Gupta, S. et al. Human organic cation transporter 1 is expressed in lymphoma cells and increases susceptibility to irinotecan and paclitaxel. J. Pharmacol. Exp. Ther. 341, 16-23 (2012). 22220752

  More...

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Human Brain, Cortex (formalin-fixed, paraffin-embedded) stained with CBLN4 antibody ARP52505_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
  IHC Information: Human Brain, Cortex (formalin-fixed, paraffin-embedded) stained with CBLN4 antibody ARP52505_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CBLN4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CBLN4 (ARP52505_P050) antibody is Catalog # AAP52505 (Previous Catalog # AAPP30419)

Target Info

• Reference: Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824
• Gene Symbol: CBLN4
• Gene Full Name: Cerebellin 4 precursor
• Alias Symbols: CBLNL1
• NCBI Gene Id: 140689
• Protein Name: Cerebellin-4
• Description of Target: Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. CBLN4 is a glycoprotein which shares sequence similarity with precerebellin.Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. The protein encoded by this gene is a glycoprotein which shares sequence similarity with precerebellin.
• Uniprot ID: Q9NTU7
• Protein Accession #: NP_542184
• Nucleotide Accession #: NM_080617
• Protein Size (# AA): 201
• Molecular Weight: 22kDa
• Protein Interactions: SRPK2; CBLN3;