Search Antibody, Protein, and ELISA Kit Solutions

CBLN4 Antibody - C-terminal region (ARP52505_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP52505_P050-FITC Conjugated

ARP52505_P050-HRP Conjugated

ARP52505_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Human Brain, Cortex (formalin-fixed, paraffin-embedded) stained with CBLN4 antibody ARP52505_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
IHC Information: Human Brain, Cortex (formalin-fixed, paraffin-embedded) stained with CBLN4 antibody ARP52505_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-133453 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the C terminal region of human CBLN4
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-CBLN4 (ARP52505_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CBLN4 (ARP52505_P050) antibody is Catalog # AAP52505 (Previous Catalog # AAPP30419)
Printable datasheet for anti-CBLN4 (ARP52505_P050) antibody
Target Reference:
Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824

Gupta, S. et al. Human organic cation transporter 1 is expressed in lymphoma cells and increases susceptibility to irinotecan and paclitaxel. J. Pharmacol. Exp. Ther. 341, 16-23 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22220752

Gene Symbol:
Official Gene Full Name:
Cerebellin 4 precursor
Alias Symbols:
NCBI Gene Id:
Protein Name:
Description of Target:
Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. CBLN4 is a glycoprotein which shares sequence similarity with precerebellin.Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. The protein encoded by this gene is a glycoprotein which shares sequence similarity with precerebellin.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CBLN4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CBLN4.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...