Search Antibody, Protein, and ELISA Kit Solutions

CBLN3 Antibody (ARP65633_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$125.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP65633_P050-FITC Conjugated

ARP65633_P050-HRP Conjugated

ARP65633_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CBLN3
Official Gene Full Name:
cerebellin 3 precursor
NCBI Gene Id:
643866
Protein Name:
Cerebellin-3
Swissprot Id:
Q6UW01
Protein Accession #:
NP_001034860
Nucleotide Accession #:
NM_001039771
Alias Symbols:
PRO1486,
Description of Target:
Members of the precerebellin family, such as CBLN3, contain a cerebellin motif (see CBLN1; MIM 600432) and a C-terminal C1q signature domain (see MIM 120550) that mediates trimeric assembly of atypical collagen complexes. However, precerebellins do not contain a collagen motif, suggesting that they are not conventional components of the extracellular matrix (Pang et al., 2000 [PubMed 10964938]).[supplied by OMIM, Aug 2009]
Protein Size (# AA):
205
Molecular Weight:
22 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CBLN3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CBLN3.
Immunogen:
The immunogen is a synthetic peptide directed towards the following sequence FANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIF
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-CBLN3 (ARP65633_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CBLN4; CBLN2; CBLN1;
Blocking Peptide:
Available upon request
Datasheets/Manuals:
Printable datasheet for anti-CBLN3 (ARP65633_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...