Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP38578_T100
Price: $0.00
SKU
ARP38578_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CBFA2T3 (ARP38578_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CBFA2T3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: MPASRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGP
Concentration1.0 mg/ml
Blocking PeptideFor anti-CBFA2T3 (ARP38578_T100) antibody is Catalog # AAP38578 (Previous Catalog # AAPP20768)
Sample Type Confirmation

CBFA2T3 is supported by BioGPS gene expression data to be expressed in Jurkat

Gene SymbolCBFA2T3
Gene Full NameCore-binding factor, runt domain, alpha subunit 2; translocated to, 3
Alias SymbolsETO2, MTG16, MTGR2, ZMYND4, RUNX1T3
NCBI Gene Id863
Protein NameProtein CBFA2T3
Description of TargetThe t(16;21)(q24;q22) translocation is a rare but recurrent chromosomal abnormality associated with therapy-related myeloid malignancies. The translocation produces a chimeric gene made up of the 5'-region of the AML1 gene fused to the 3'-region of CBFA2T3. In addition, CBFA2T3 is a putative breast tumor suppressor.
Uniprot IDO75107
Protein Accession #BAA31276
Nucleotide Accession #NM_005187
Protein Size (# AA)545
Molecular Weight60kDa
Protein InteractionsZbtb38; Zbtb4; ZBTB33; GMEB2; SEC24A; MATN2; ZBTB47; UBC; RUNX1; TAL1; TRIM33; SIN3B; NCOR1; HDAC3; CBFA2T3; CBFA2T2; HDAC1; PRKAR2A; RUNX1T1; LDB1; TCF3; HDAC8; HDAC6; HDAC2;
  1. What is the species homology for "CBFA2T3 Antibody - N-terminal region (ARP38578_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CBFA2T3 Antibody - N-terminal region (ARP38578_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CBFA2T3 Antibody - N-terminal region (ARP38578_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CBFA2T3 Antibody - N-terminal region (ARP38578_T100)"?

    This target may also be called "ETO2, MTG16, MTGR2, ZMYND4, RUNX1T3" in publications.

  5. What is the shipping cost for "CBFA2T3 Antibody - N-terminal region (ARP38578_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CBFA2T3 Antibody - N-terminal region (ARP38578_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CBFA2T3 Antibody - N-terminal region (ARP38578_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CBFA2T3 Antibody - N-terminal region (ARP38578_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CBFA2T3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CBFA2T3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CBFA2T3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CBFA2T3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CBFA2T3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CBFA2T3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CBFA2T3 Antibody - N-terminal region (ARP38578_T100)
Your Rating
We found other products you might like!