Protein on Demand™ CAV3 Recombinant Protein (Rat) (OPCA15953)

Datasheets/Manuals	Printable datasheet for OPCA15953

Product Info
Predicted Species Reactivity	Rat
Product Format	Liquid
Application	WB, ELISA
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	MMTEEHTDLEARIIKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWRVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSNIKVVLRREG
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	1-151

Gene Full Name	caveolin 3
NCBI Gene Id	29161
Protein Name	caveolin-3
Description of Target	regulates basal GTPase activity of purified heterotrimeric G-proteins and binds to and regulates the activity of endothelial nitric oxide synthase (eNOS); may play a role in stress fiber constriction in spleen sinus endothelial cells [RGD, Feb 2006]
Uniprot ID	P51638
Protein Size (# AA)	151