CAV3 Recombinant Protein (Human) (OPCA04820)

Catalog No: OPCA04820

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV
• Protein Sequence: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-151 aa
• Tag: N-terminal GST-tagged
• Reference: Mutations in the caveolin-3 gene cause autosomal dominant limb-girdle muscular dystrophy. Minetti C., Sotgia F., Bruno C., Scartezzini P., Broda P., Bado M., Masetti E., Mazzocco M., Egeo A., Donati M.A., Volonte D., Galbiati F., Cordone G., Bricarelli F.D., Lisanti M.P., Zara F. Nat. Genet. 18:365-368(1998)

Target Info

• Gene Symbol: CAV3
• Gene Full Name: caveolin 3
• Alias Symbols: caveolin-3;cavolin 3;LGMD1C;LQT9;M-caveolin;MPDT;RMD2;VIP21;VIP-21.
• NCBI Gene Id: 859
• Protein Name: Caveolin-3
• Description of Target: May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. May also regulate voltage-gated potassium channels. Plays a role in the sarcolemma repair mechanism of both skeletal muscle and cardiomyocytes that permits rapid resealing of membranes disrupted by mechanical stress (By similarity). Mediates the recruitment of CAVIN2 and CAVIN3 proteins to the caveolae (PubMed:19262564).
• Uniprot ID: P56539
• Protein Accession #: NP_001225
• Nucleotide Accession #: NM_001234
• Protein Size (# AA): Recombinant
• Molecular Weight: 44.3 kDa