CAV2 Antibody - N-terminal region : HRP (AVARP09020_P050-HRP)

Catalog No: AVARP09020_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAV2
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CAV2 (AVARP09020_P050-HRP) antibody is Catalog # AAP30145 (Previous Catalog # AAPP00302)
• Reference: Sowa,G., (2008) Biochemistry 47 (1), 101-111
• Publications:

  Chi Sabins, N. et al. DLK1: a novel target for immunotherapeutic remodeling of the tumor blood vasculature. Mol. Ther. 21, 1958-68 (2013). WB, IHC, ELISA, Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 23896726

Target Info

• Gene Symbol: CAV2
• Gene Full Name: Caveolin 2
• Alias Symbols: CAV
• NCBI Gene Id: 858
• Protein Name: Caveolin-2
• Description of Target: CAV2 is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.
• Uniprot ID: P51636
• Protein Accession #: NP_001224
• Nucleotide Accession #: NM_001233
• Protein Size (# AA): 162
• Molecular Weight: 18kDa
• Protein Interactions: EGFR; PTGS1; CSNK2A1; CAV1; MALL; KCNMA1; UBC; DNAJA1; GOLGB1; NCK1; SRC; RASA1; FLOT2; DRD1; PLD2;