Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CAV2 antibody - N-terminal region (AVARP09020_P050)

100 ul
$289.00
In Stock

Conjugation Options

AVARP09020_P050-FITC Conjugated

AVARP09020_P050-HRP Conjugated

AVARP09020_P050-Biotin Conjugated

Gene Symbol:
CAV2
NCBI Gene Id:
858
Official Gene Full Name:
Caveolin 2
Protein Name:
Caveolin-2
Swissprot Id:
P51636
Protein Accession #:
NP_001224
Nucleotide Accession #:
NM_001233
Alias Symbols:
CAV, MGC12294
Replacement Item:
This antibody may replace item sc-7942 from Santa Cruz Biotechnology.
Description of Target:
CAV2 is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.
Protein Size (# AA):
162
Molecular Weight:
18kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CAV2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CAV2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CAV2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-CAV2 (AVARP09020_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
EGFR; PTGS1; CSNK2A1; CAV1; MALL; KCNMA1; UBC; DNAJA1; GOLGB1; NCK1; SRC; RASA1; FLOT2; DRD1; PLD2;
Blocking Peptide:
For anti-CAV2 (AVARP09020_P050) antibody is Catalog # AAP30145 (Previous Catalog # AAPP00302)
Datasheets/Manuals:
Printable datasheet for anti-CAV2 (AVARP09020_P050) antibody
Target Reference:
Sowa,G., (2008) Biochemistry 47 (1), 101-111
Publications:

Chi Sabins, N. et al. DLK1: a novel target for immunotherapeutic remodeling of the tumor blood vasculature. Mol. Ther. 21, 1958-68 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23896726

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:24
  • Overall Experience:
  • Quality:
Product Review: CAV2 antibody - N-terminal region (AVARP09020_P050) in Human placental tissue using IHC
Product Page for CAV2 antibody - N-terminal region (AVARP09020_P050)

Researcher: Dr. Hiten D. Mistry and Anna Czajka, King's College London; Lesia Kurlak, University of Nottingham
Application: IHC
Species + Tissue/Cell type: Human placental tissue
Primary antibody dilution: 1:50
Secondary antibody: Goat anti rabbit-HRP
Secondary antibody dilution: 1:10,000


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? It is one of our main antibodies of interest.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? No
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes
How did you store the antibody after re-suspension? -20 d C
Sample Description (please include species type and tissue/cell type): Human Placental tissues samples, paraffin-embedded slides.
Please explain fixation solution/method used (formalin, periodate-lysine-paraformaldehyde, acetone, etc.)? Formalin fixed
How many different experimental trials were conducted using the antibody sample? 6
Primary antibody dilution, incubation time and temperature: 1 in 200 dilution
Secondary antibody used, dilution, incubation time and temperature: 1 in 10000 goat anti rabbit, 30 minutes at room temperature
From your IHC/ICC images, briefly explain the colors of each stain and counterstain: DAB staining and counter stained with haemotoxylin
Did you use an antigen retrieval method? If so, please explain? Heat-induced antigen retrieval method.
What controls were used in your experiment? Negative control: IgG rabbit negative. Positive control: Skeletal muscle.
Please include your detailed tissue preparation and staining procedure/protocol here: Mount paraffin-embedded sections on APES-coated slides. Dry the sections overnight 37 d C.
1. Dewax sections in xylene baths (2x5mins)
2. Immerse in absolute alcohol (IMS is cheaper) (2x5 mins)
3. Immerse in fresh 0.5% H2O2 in methanol-peroxidase block (store up to max 1wk at 4 d C) (10 mins)
4. Immerse in alcohol (2x5 mins)
5. Immerse in 70% alcohol (5 mins)
6. Wash in runnig water (5 mins)
7. Microwave for 15 mins at medium setting in Citrate buffer solution (Heat induced epitope retieval). Time dependson equipment [20 mins on high power]
8. Leave to stand for a few mins before cooling in running water [at least 15 mins total]
9. Wash in TBS (5 mins)
10. Wipe off excess TBS and draw around section with hydrophobic barrier pen pen, block with appropriate for

secondary Ab normal serum (dil 1/10 in TBS/BSA) (30 mins)
11. Incubate in primary Ab (dil in BS/BSA) overnight at 4 d C, then 30-60 mins at room temp.
12. Wash in TBS (2x6 mins)
13. Incubate with HRP-labelled polymer (secondary Ab) at room temp, neat if part of kit or concentration as

assessed in a validation run (30 mins)
14. Wash in TBS (2x5 mins)
15. In cubate in DAB chromogen [make up in separate tube at 1ml of buffer + 20ul DAB] (1x10 mins)
16. Wash in running water for a few minutes
17. Counter stain in Harris' Haematoxylin (1x12 secs)
18. Wash in running water
19. Blue in Scott's Tap water. Look at slide under microscope (5 secs)
20. Wash in running water
21. If too blue, dip in acid alcohol.
22. Wash in running water
23. Dip in Scott's Tap water (5 secs)
24. Wash in running water
25. Transport in water/TBS
26. Immerse in 70% alcohol (5 mins)
27. Immerse in 100% alcohol (2x5 mins)
28. Clear in xylene (III and iv) (2x5 mins)
29. Mount in DPX
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...