Catalog No: ARP35455_T100
Price: $0.00
SKU
ARP35455_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CATSPER2 (ARP35455_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CATSPER2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Horse: 92%; Human: 100%; Pig: 92%; Rabbit: 100%
Peptide SequenceSynthetic peptide located within the following region: HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA
Concentration1.0 mg/ml
Blocking PeptideFor anti-CATSPER2 (ARP35455_T100) antibody is Catalog # AAP35455 (Previous Catalog # AAPP06692)
Sample Type Confirmation

CATSPER2 is supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceQuill,T.A., et al., (2001) Natl. Acad. Sci. U.S.A. 98 (22), 12527-12531
Publications

Kawano, N. et al. Seminal vesicle protein SVS2 is required for sperm survival in the uterus. Proc. Natl. Acad. Sci. U. S. A. 111, 4145-50 (2014). 24591616

Gene SymbolCATSPER2
Gene Full NameCation channel, sperm associated 2
NCBI Gene Id117155
Protein NameCation channel sperm-associated protein 2
Description of TargetCalcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined.
Uniprot IDQ96P54
Protein Accession #NP_742094
Nucleotide Accession #NM_172096
Protein Size (# AA)414
Molecular Weight46kDa
  1. What is the species homology for "CATSPER2 Antibody - N-terminal region (ARP35455_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Horse, Pig, Rabbit".

  2. How long will it take to receive "CATSPER2 Antibody - N-terminal region (ARP35455_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CATSPER2 Antibody - N-terminal region (ARP35455_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CATSPER2 Antibody - N-terminal region (ARP35455_T100)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "CATSPER2 Antibody - N-terminal region (ARP35455_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CATSPER2 Antibody - N-terminal region (ARP35455_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CATSPER2 Antibody - N-terminal region (ARP35455_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CATSPER2 Antibody - N-terminal region (ARP35455_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CATSPER2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CATSPER2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CATSPER2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CATSPER2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CATSPER2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CATSPER2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CATSPER2 Antibody - N-terminal region (ARP35455_T100)
Your Rating
We found other products you might like!