Size:100 ul
Special Price $229.00 Regular Price $249.00
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35455_T100-FITC Conjugated

ARP35455_T100-HRP Conjugated

ARP35455_T100-Biotin Conjugated

CATSPER2 Antibody - N-terminal region (ARP35455_T100)

Catalog#: ARP35455_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Horse, Human, Pig, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-83119 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CATSPER2
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 85%; Horse: 92%; Human: 100%; Pig: 92%; Rabbit: 100%
Complete computational species homology data Anti-CATSPER2 (ARP35455_T100)
Peptide Sequence Synthetic peptide located within the following region: HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CATSPER2 (ARP35455_T100) antibody is Catalog # AAP35455 (Previous Catalog # AAPP06692)
Datasheets/Manuals Printable datasheet for anti-CATSPER2 (ARP35455_T100) antibody
Sample Type Confirmation

CATSPER2 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Quill,T.A., et al., (2001) Natl. Acad. Sci. U.S.A. 98 (22), 12527-12531

Kawano, N. et al. Seminal vesicle protein SVS2 is required for sperm survival in the uterus. Proc. Natl. Acad. Sci. U. S. A. 111, 4145-50 (2014). IHC, WB, Cow, Horse, Human, Pig, Rabbit 24591616

Gene Symbol CATSPER2
Official Gene Full Name Cation channel, sperm associated 2
NCBI Gene Id 117155
Protein Name Cation channel sperm-associated protein 2
Description of Target Calcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined.
Swissprot Id Q96P54
Protein Accession # NP_742094
Nucleotide Accession # NM_172096
Protein Size (# AA) 414
Molecular Weight 46kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CATSPER2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CATSPER2.
Write Your Own Review
You're reviewing:CATSPER2 Antibody - N-terminal region (ARP35455_T100)
Your Rating