Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CATSPER2 Antibody - N-terminal region (ARP35455_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35455_T100-FITC Conjugated

ARP35455_T100-HRP Conjugated

ARP35455_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Cation channel, sperm associated 2
NCBI Gene Id:
Protein Name:
Cation channel sperm-associated protein 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Replacement Item:
This antibody may replace item sc-83119 from Santa Cruz Biotechnology.
Description of Target:
Calcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CATSPER2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CATSPER2.
The immunogen is a synthetic peptide directed towards the N terminal region of human CATSPER2
Predicted Species Reactivity:
Cow, Horse, Human, Pig, Rabbit
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Horse: 92%; Human: 100%; Pig: 92%; Rabbit: 100%
Complete computational species homology data:
Anti-CATSPER2 (ARP35455_T100)
Peptide Sequence:
Synthetic peptide located within the following region: HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CATSPER2 (ARP35455_T100) antibody is Catalog # AAP35455 (Previous Catalog # AAPP06692)
Printable datasheet for anti-CATSPER2 (ARP35455_T100) antibody
Sample Type Confirmation:

CATSPER2 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Quill,T.A., et al., (2001) Natl. Acad. Sci. U.S.A. 98 (22), 12527-12531

Kawano, N. et al. Seminal vesicle protein SVS2 is required for sperm survival in the uterus. Proc. Natl. Acad. Sci. U. S. A. 111, 4145-50 (2014). IHC, WB, Cow, Horse, Human, Pig, Rabbit 24591616

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...