Search Antibody, Protein, and ELISA Kit Solutions

CASP9 Antibody - middle region : FITC (ARP72517_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72517_P050 Unconjugated

ARP72517_P050-HRP Conjugated

ARP72517_P050-Biotin Conjugated

Gene Symbol:
CASP9
NCBI Gene Id:
842
Swissprot Id:
P55211-2
Alias Symbols:
CASP9, MCH6,
Replacement Item:
This antibody may replace item sc-133109 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein can undergo autoproteolytic processing and activation by the apoptosome, a protein complex of cytochrome c and the apoptotic peptidase activating factor 1; this step is thought to be one of the earliest in the caspase activation cascade. This protein is thought to play a central role in apoptosis and to be a tumor suppressor. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
266
Molecular Weight:
29kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CASP9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CASP9.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human CASP9
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: QKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
BAX; XIAP; BIRC2; APAF1; BIRC8; BIRC7; ABL1; PTCH1; CRYAB; SQSTM1; JUN; CASP7; CASP3; BRCA1; RB1; MSTO1; HSD17B4; BIRC3; VCP; BIRC6; UBC; RNF2; MZB1; CARD8; GMEB1; NAIP; NLRP1; NOD1; DIABLO; BCL10; BIRC5; ILK; CASP9; MAPK3; HIP1; CASP10; MAP2K2; SRF; BCL2
Blocking Peptide:
For anti-CASP9 (ARP72517_P050-FITC) antibody is Catalog # AAP72517
Datasheets/Manuals:
Printable datasheet for anti-CASP9 (ARP72517_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...