Search Antibody, Protein, and ELISA Kit Solutions

CASP8 Antibody - C-terminal region : FITC (ARP72515_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72515_P050 Unconjugated

ARP72515_P050-HRP Conjugated

ARP72515_P050-Biotin Conjugated

Gene Symbol:
CASP8
NCBI Gene Id:
841
Swissprot Id:
Q14790-3
Alias Symbols:
CASP8, MCH5,
Replacement Item:
This antibody may replace item sc-114794 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain, a large protease subunit, and a small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This protein is involved in the programmed cell death induced by Fas and various apoptotic stimuli. The N-terminal FADD-like death effector domain of this protein suggests that it may interact with Fas-interacting protein FADD. This protein was detected in the insoluble fraction of the affected brain region from Huntington disease patients but not in those from normal controls, which implicated the role in neurodegenerative diseases. Many alternatively spliced transcript variants encoding different isoforms have been described, although not all variants have had their full-length sequences determined.
Protein Size (# AA):
395
Molecular Weight:
43kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CASP8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CASP8.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CASP8
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
BAX; ced-4; FADD; UBC; ERLIN2; PRDX6; TNF; CRYAB; XIAP; TNFSF10; RIPK1; HECTD3; SQSTM1; GZMB; PLA2G4B; RB1; PLIN4; BCAP31; PDIA6; CFLAR; SNRPD3; PRKCI; BIRC2; RIPK3; TNFRSF10A; TNFRSF10B; CUL3; TRAF2; CASP10; PARK7; LRRK2; CARD11; FIS1; CASP3; FASLG; TOPO
Blocking Peptide:
For anti-CASP8 (ARP72515_P050-FITC) antibody is Catalog # AAP72515
Datasheets/Manuals:
Printable datasheet for anti-CASP8 (ARP72515_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...