Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP58992_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58992_P050-FITC Conjugated

ARP58992_P050-HRP Conjugated

ARP58992_P050-Biotin Conjugated

CASP5 Antibody - middle region (ARP58992_P050)

Rating:
80% of 100
Catalog#: ARP58992_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Guinea Pig, Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, FC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-1780 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CASP5
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 83%; Guinea Pig: 82%; Human: 100%
Complete computational species homology data Anti-CASP5 (ARP58992_P050)
Peptide Sequence Synthetic peptide located within the following region: VIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CASP5 (ARP58992_P050) antibody is Catalog # AAP58992 (Previous Catalog # AAPP44959)
Datasheets/Manuals Printable datasheet for anti-CASP5 (ARP58992_P050) antibody
Gene Symbol CASP5
Official Gene Full Name Caspase 5, apoptosis-related cysteine peptidase
Alias Symbols ICE(rel)III, ICEREL-III, ICH-3, MGC141966
NCBI Gene Id 838
Protein Name Caspase-5
Description of Target This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. Overexpression of the active form of this enzyme induces apoptosis in fibroblasts. Max, a central component of the Myc/Max/Mad transcription regulation network important for cell growth, differentiation, and apoptosis, is cleaved by this protein; this process requires Fas-mediated dephosphorylation of Max. The expression of this gene is regulated by interferon-gamma and lipopolysaccharide. Alternatively spliced transcript variants have been identified for this gene.
Swissprot Id P51878
Protein Accession # NP_001129581
Nucleotide Accession # NM_001136109
Protein Size (# AA) 376
Molecular Weight 43kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CASP5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CASP5.
Protein Interactions PPHLN1; NLRP1; CASP5; MAX;
Write Your Own Review
You're reviewing:CASP5 Antibody - middle region (ARP58992_P050)
Your Rating