Search Antibody, Protein, and ELISA Kit Solutions

CASP5 Antibody - middle region (ARP58992_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58992_P050-FITC Conjugated

ARP58992_P050-HRP Conjugated

ARP58992_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Guinea Pig, Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, FC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
CASP5
Official Gene Full Name:
Caspase 5, apoptosis-related cysteine peptidase
NCBI Gene Id:
838
Protein Name:
Caspase-5
Swissprot Id:
P51878
Protein Accession #:
NP_001129581
Nucleotide Accession #:
NM_001136109
Alias Symbols:
ICE(rel)III, ICEREL-III, ICH-3, MGC141966
Replacement Item:
This antibody may replace item sc-1780 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. Overexpression of the active form of this enzyme induces apoptosis in fibroblasts. Max, a central component of the Myc/Max/Mad transcription regulation network important for cell growth, differentiation, and apoptosis, is cleaved by this protein; this process requires Fas-mediated dephosphorylation of Max. The expression of this gene is regulated by interferon-gamma and lipopolysaccharide. Alternatively spliced transcript variants have been identified for this gene.
Protein Size (# AA):
376
Molecular Weight:
43kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CASP5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CASP5.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CASP5
Predicted Homology Based on Immunogen Sequence:
Cow: 83%; Guinea Pig: 82%; Human: 100%
Complete computational species homology data:
Anti-CASP5 (ARP58992_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFI
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PPHLN1; NLRP1; CASP5; MAX;
Blocking Peptide:
For anti-CASP5 (ARP58992_P050) antibody is Catalog # AAP58992 (Previous Catalog # AAPP44959)
Datasheets/Manuals:
Printable datasheet for anti-CASP5 (ARP58992_P050) antibody

Product Reviews

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

233/08/2019 23:47
  • Quality:
  • Overall Experience:
HCT116 cells, CHO cells in FC

Submitted by:
Mark Gorris
Radboudumc


"Aviva CASP5 antibody was working nicely for flow cytometry. We validated this with CHO cells transfected with CASP5 and a colorectal cell line HCT116 with and without IFNy (we saw one qPCR that only IFNy induced CASP5 and this we also saw on the flow)."


CASP5
1. Sample type: Colorectal cell line HCT116 cells O/N treated with IFNγ or untreated.


2. Primary antibody dilution: Intracellular labeling using the FOXP3 Buffer Set. 1:100 (5ug/ml) for 30 minutes at RT.


3. Secondary antibody and dilution: GαRb IgG alexa647; 1:400.


4. What controls were used in your experiment: CHO cells transfected with CASP5 and without CASP5.


5. How did you store the antibody after resuspension: It was already resuspended and we kept it in the -20C.


6. How many different experimental trials were conducted using the antibody sample? 1

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...