Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
AVARP00021_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP00021_T100-FITC Conjugated

AVARP00021_T100-HRP Conjugated

AVARP00021_T100-Biotin Conjugated

CASP3 Antibody - N-terminal region (AVARP00021_T100)

Catalog#: AVARP00021_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-113427, HPA002643
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CASP3
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 84%; Dog: 84%; Guinea Pig: 84%; Horse: 92%; Human: 100%; Pig: 92%; Rabbit: 84%; Rat: 84%
Complete computational species homology data Anti-CASP3 (AVARP00021_T100)
Peptide Sequence Synthetic peptide located within the following region: MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CASP3 (AVARP00021_T100) antibody is Catalog # AAP30492 (Previous Catalog # AAPP01128)
Datasheets/Manuals Printable datasheet for anti-CASP3 (AVARP00021_T100) antibody
Target Reference Selvakumar,P., et al., (2006) FEBS Lett. 580 (8), 2021-2026
Publications

Jeong, YG; Lee, JS; Shim, JK; Hur, W; A scaffold-free surface culture of B16F10 murine melanoma cells based on magnetic levitation. 68, 2323-2334 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat 27670438

Gene Symbol CASP3
Official Gene Full Name Caspase 3, apoptosis-related cysteine peptidase
Alias Symbols CPP32, SCA-1, CPP32B
NCBI Gene Id 836
Protein Name Caspase-3
Description of Target CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein.
Swissprot Id P42574
Protein Accession # NP_004337
Nucleotide Accession # NM_004346
Protein Size (# AA) 277
Molecular Weight 32kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CASP3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CASP3.
Protein Interactions BAX; PARP1; PTGES3; XIAP; CRYAB; BIRC7; UBC; MDM2; Gzmb; VIM; STAT1; SPTAN1; ROCK1; GSN; DFFA; CASP9; CASP7; CASP6; CASP2; BID; ARHGDIA; TNFSF10; PLA2G4B; CDKN1A; RB1; PRKDC; GLRX; GATA1; SOCS5; YWHAG; MAPK9; MAPK8; SP1; PKN1; CASP8; BIRC3; BIRC2; ZBTB16;
  1. What is the species homology for "CASP3 Antibody - N-terminal region (AVARP00021_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat".

  2. How long will it take to receive "CASP3 Antibody - N-terminal region (AVARP00021_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CASP3 Antibody - N-terminal region (AVARP00021_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CASP3 Antibody - N-terminal region (AVARP00021_T100)"?

    This target may also be called "CPP32, SCA-1, CPP32B" in publications.

  5. What is the shipping cost for "CASP3 Antibody - N-terminal region (AVARP00021_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CASP3 Antibody - N-terminal region (AVARP00021_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CASP3 Antibody - N-terminal region (AVARP00021_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "32kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CASP3 Antibody - N-terminal region (AVARP00021_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CASP3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CASP3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CASP3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CASP3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CASP3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CASP3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CASP3 Antibody - N-terminal region (AVARP00021_T100)
Your Rating
We found other products you might like!