Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CASP3 Antibody - N-terminal region (AVARP00021_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP00021_T100-FITC Conjugated

AVARP00021_T100-HRP Conjugated

AVARP00021_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Caspase 3, apoptosis-related cysteine peptidase
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CPP32, SCA-1, CPP32B
Replacement Item:
This antibody may replace item sc-113427, HPA002643
Description of Target:
CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CASP3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CASP3.
The immunogen is a synthetic peptide directed towards the N terminal region of human CASP3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 84%; Dog: 84%; Guinea Pig: 84%; Horse: 92%; Human: 100%; Pig: 92%; Rabbit: 84%; Rat: 84%
Complete computational species homology data:
Anti-CASP3 (AVARP00021_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CASP3 (AVARP00021_T100) antibody is Catalog # AAP30492 (Previous Catalog # AAPP01128)
Printable datasheet for anti-CASP3 (AVARP00021_T100) antibody
Target Reference:
Selvakumar,P., et al., (2006) FEBS Lett. 580 (8), 2021-2026

Jeong, YG; Lee, JS; Shim, JK; Hur, W; A scaffold-free surface culture of B16F10 murine melanoma cells based on magnetic levitation. 68, 2323-2334 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat 27670438

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...