SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP59000_P050
Price: $0.00
SKU
ARP59000_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CASP10 (ARP59000_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CASP10
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: HNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIP
Concentration0.5 mg/ml
Blocking PeptideFor anti-CASP10 (ARP59000_P050) antibody is Catalog # AAP59000 (Previous Catalog # AAPP45307)
Gene SymbolCASP10
Gene Full NameCaspase 10, apoptosis-related cysteine peptidase
Alias SymbolsMCH4, ALPS2, FLICE2, FLICE-2
NCBI Gene Id843
Protein NameCaspase-10
Description of TargetThis gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 3 and 7, and the protein itself is processed by caspase 8. Mutations in this gene are associated with apoptosis defects seen in type II autoimmune lymphoproliferative syndrome. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Uniprot IDQ92851
Protein Accession #NP_001221
Nucleotide Accession #NM_001230
Protein Size (# AA)479
Molecular Weight12kDa
Protein InteractionsFADD; PRDX6; XIAP; RB1; Dlg4; PHF20L1; OIP5; ECE2; RIOK3; NFKBIL1; CASP8; RNF34; BFAR; CASP8AP2; MSN2; PTC2; AIM9; GLN3; SLT2; GPA1; STE20; ATG13; RPL21B; VPS30; CUP9; TPK2; GAL4; FAR11; WHI3; ATG4; FAR3; FAR8; ITT1; MPH1; SSM4; ASG1; BFR1; ORT1; MBR1; CW
  1. What is the species homology for "CASP10 Antibody - middle region (ARP59000_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CASP10 Antibody - middle region (ARP59000_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CASP10 Antibody - middle region (ARP59000_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CASP10 Antibody - middle region (ARP59000_P050)"?

    This target may also be called "MCH4, ALPS2, FLICE2, FLICE-2" in publications.

  5. What is the shipping cost for "CASP10 Antibody - middle region (ARP59000_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CASP10 Antibody - middle region (ARP59000_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CASP10 Antibody - middle region (ARP59000_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "12kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CASP10 Antibody - middle region (ARP59000_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CASP10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CASP10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CASP10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CASP10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CASP10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CASP10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CASP10 Antibody - middle region (ARP59000_P050)
Your Rating
We found other products you might like!