CASP1 Recombinant Protein (Human) (OPCA00604)

Catalog No: OPCA00604

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Tag information : GST tag
  
• Reconstitution and Storage: -20°C or -80°C
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN
• Protein Sequence: NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 120-269 aa
• Tag: N-terminal GST-tagged
• Reference: A novel heterodimeric cysteine protease is required for interleukin-1 beta processing in monocytes.Thornberry N.A., Bull H.G., Calaycay J.R., Chapman K.T., Howard A.D., Kostura M.J., Miller D.K., Molineaux S.M., Weidner J.R., Aunins J., Elliston K.O., Ayala J.M., Casano F.J., Chin J., Ding G.J.-F., Egger L.A., Gaffney E.P., Limjuco G. , Palyha O.C., Raju M., Rolando A.M., Salley J.P., Yamin T.-T., Lee T.D., Shively J.E., McCross M., Mumford R.A., Schmidt J.A., Tocci M.J.Nature 356:768-774(1992)

Target Info

• Gene Symbol: CASP1
• Gene Full Name: caspase 1
• Alias Symbols: CASP1 nirs variant 1;caspase 1, apoptosis-related cysteine peptidase;caspase-1;caspase-1 isoform alpha;ICE;IL-1 beta-converting enzyme;IL1BC;IL1B-convertase;interleukin 1, beta, convertase;interleukin 1-B converting enzyme;Interleukin-1 beta convertase;Interleukin-1 beta-converting enzyme;P45.
• NCBI Gene Id: 834
• Protein Name: Caspase-1
• Description of Target: Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive (PubMed:28314590).
• Uniprot ID: P29466
• Protein Size (# AA): Recombinant
• Molecular Weight: 43.8 kDa