Search Antibody, Protein, and ELISA Kit Solutions

CASK Antibody - middle region (ARP80945_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
calcium/calmodulin-dependent serine protein kinase (MAGUK family)
NCBI Gene Id:
Protein Name:
peripheral plasma membrane protein CASK
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes a calcium/calmodulin-dependent serine protein kinase. The encoded protein is a MAGUK (membrane-associated guanylate kinase) protein family member. These proteins are scaffold proteins and the encoded protein is located at synapses in the brain. Mutations in this gene are associated with FG syndrome 4, mental retardation and microcephaly with pontine and cerebellar hypoplasia, and a form of X-linked mental retardation. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
98 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CASK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CASK.
The immunogen is a synthetic peptide directed towards the middle region of human CASK
Peptide Sequence:
Synthetic peptide located within the following region: HPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CASK (ARP80945_P050) antibody is Catalog # AAP80945
Printable datasheet for anti-CASK (ARP80945_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...