Search Antibody, Protein, and ELISA Kit Solutions

CARM1 Antibody - C-terminal region : FITC (ARP72589_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72589_P050 Unconjugated

ARP72589_P050-HRP Conjugated

ARP72589_P050-Biotin Conjugated

Gene Symbol:
CARM1
NCBI Gene Id:
10498
Swissprot Id:
Q86X55-1
Protein Accession #:
XP_005259765
Alias Symbols:
CARM1, PRMT4,
Replacement Item:
This antibody may replace item sc-119000 from Santa Cruz Biotechnology.
Description of Target:
This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9.
Protein Size (# AA):
585
Molecular Weight:
64kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CARM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CARM1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CARM1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPPGSHYTSPSENMWNTG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
CACYBP; NUDCD3; DROSHA; TNRC6B; PPAT; ILK; DAXX; PARVA; SPAG8; PYGO1; XPO7; FAF1; NUDT21; MALT1; HSPH1; QKI; DNAJA3; UGP2; UBE2I; SUPT5H; HNRNPA1; METTL21C; gag-pol; UBC; EP300; TP63; RABGAP1; COPS5; CUL1; CUL2; CUL3; CUL5; CAND1; HHV8GK18_gp81; HIST1H3A;
Blocking Peptide:
For anti-CARM1 (ARP72589_P050-FITC) antibody is Catalog # AAP72589
Datasheets/Manuals:
Printable datasheet for anti-CARM1 (ARP72589_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...