CARD8 Antibody - N-terminal region (ARP55119_P050)

Catalog No: ARP55119_P050

Host: Rabbit
Target Name: CARD8
Sample Type: Fetal spleen lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CARD8
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELID
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CARD8 (ARP55119_P050) antibody is Catalog # AAP55119

Target Info

• Gene Symbol: CARD8
• Gene Full Name: caspase recruitment domain family, member 8
• Alias Symbols: NDPP, DACAR, DAKAR, NDPP1, TUCAN, CARDINAL
• NCBI Gene Id: 22900
• Protein Name: Caspase recruitment domain-containing protein 8
• Description of Target: The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene.
• Uniprot ID: Q9Y2G2-2
• Protein Size (# AA): 286
• Molecular Weight: 31kDa
• Protein Interactions: ELAVL1; CARD16; CARD8; CARD18; NLRP2; NLRP3; FHL2; CASP9; IKBKG; CASP1; CARD6;