Search Antibody, Protein, and ELISA Kit Solutions

CARD14 Antibody - middle region (ARP84936_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
CARD14
Official Gene Full Name:
caspase recruitment domain family member 14
NCBI Gene Id:
79092
Protein Name:
caspase recruitment domain-containing protein 14
Swissprot Id:
Q9BXL6
Protein Accession #:
NP_001244899.1
Nucleotide Accession #:
NM_001257970.1
Alias Symbols:
PRP, PSS1, BIMP2, CARMA2, PSORS2
Description of Target:
This gene encodes a caspase recruitment domain-containing protein that is a member of the membrane-associated guanylate kinase (MAGUK) family of proteins. Members of this protein family are scaffold proteins that are involved in a diverse array of cellular processes including cellular adhesion, signal transduction and cell polarity control. This protein has been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. Alternate splicing results in multiple transcript variants.
Protein Size (# AA):
1004
Molecular Weight:
110 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CARD14.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CARD14.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CARD14
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: QQCTVTRKPSSGGPQKLVRIVSMDKAKASPLRLSFDRGQLDPSRMEGSST
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CARD14 (ARP84936_P050) antibody is Catalog # AAP84936
Datasheets/Manuals:
Printable datasheet for anti-CARD14 (ARP84936_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...