Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP62108_P050
Price: $0.00
SKU
ARP62108_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CAPZA2 (ARP62108_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: DLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAH
Concentration0.5 mg/ml
Blocking PeptideFor anti-CAPZA2 (ARP62108_P050) antibody is Catalog # AAP62108
Subunitalpha-2
Gene SymbolCAPZA2
Gene Full NameCapping protein (actin filament) muscle Z-line, alpha 2
Alias SymbolsCAPZ, CAPPA2
NCBI Gene Id830
Protein NameF-actin-capping protein subunit alpha-2
Description of TargetThe protein encoded by this gene is a member of the F-actin capping protein alpha subunit family. It is the alpha subunit of the barbed-end actin binding protein Cap Z. By capping the barbed end of actin filaments, Cap Z regulates the growth of the actin filaments at the barbed end.
Uniprot IDP47755
Protein Accession #NP_006127
Nucleotide Accession #NM_006136
Protein Size (# AA)286
Molecular Weight31kDa
Protein InteractionsUBC; CAPZB; CAPZA1; AASDHPPT; TWF2; STRAP; PSMG1; SGTA; RPL18A; PTMA; PKM; PAN2; LRRK2; CD2AP; BLNK; ARRB2; ELAVL1; RBBP6; CAPZA3;
  1. What is the species homology for "CAPZA2 Antibody - N-terminal region (ARP62108_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "CAPZA2 Antibody - N-terminal region (ARP62108_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CAPZA2 Antibody - N-terminal region (ARP62108_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CAPZA2 Antibody - N-terminal region (ARP62108_P050)"?

    This target may also be called "CAPZ, CAPPA2" in publications.

  5. What is the shipping cost for "CAPZA2 Antibody - N-terminal region (ARP62108_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CAPZA2 Antibody - N-terminal region (ARP62108_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CAPZA2 Antibody - N-terminal region (ARP62108_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "31kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CAPZA2 Antibody - N-terminal region (ARP62108_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CAPZA2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CAPZA2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CAPZA2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CAPZA2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CAPZA2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CAPZA2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CAPZA2 Antibody - N-terminal region (ARP62108_P050)
Your Rating
We found other products you might like!