Loading...
Catalog No: ARP58435_P050
Price: $0.00
SKU
ARP58435_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CAPS (ARP58435_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CAPS
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHorse: 85%; Human: 100%; Pig: 77%; Rabbit: 92%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA
Concentration0.5 mg/ml
Blocking PeptideFor anti-CAPS (ARP58435_P050) antibody is Catalog # AAP58435 (Previous Catalog # AAPP34551)
ReferenceGrimwood,J., (2004) Nature 428 (6982), 529-535
Gene SymbolCAPS
Gene Full NameCalcyphosine
Alias SymbolsCAPS1
NCBI Gene Id828
Protein NameCalcyphosin
Description of TargetCAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants.
Uniprot IDQ13938
Protein Accession #NP_004049
Nucleotide Accession #NM_004058
Protein Size (# AA)189
Molecular Weight21kDa
  1. What is the species homology for "CAPS Antibody - N-terminal region (ARP58435_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Horse, Pig, Rabbit".

  2. How long will it take to receive "CAPS Antibody - N-terminal region (ARP58435_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CAPS Antibody - N-terminal region (ARP58435_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CAPS Antibody - N-terminal region (ARP58435_P050)"?

    This target may also be called "CAPS1" in publications.

  5. What is the shipping cost for "CAPS Antibody - N-terminal region (ARP58435_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CAPS Antibody - N-terminal region (ARP58435_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CAPS Antibody - N-terminal region (ARP58435_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CAPS Antibody - N-terminal region (ARP58435_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CAPS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CAPS"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CAPS"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CAPS"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CAPS"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CAPS"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CAPS Antibody - N-terminal region (ARP58435_P050)
Your Rating