Search Antibody, Protein, and ELISA Kit Solutions

CAPNS1 Antibody - middle region (ARP58434_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58434_P050-FITC Conjugated

ARP58434_P050-HRP Conjugated

ARP58434_P050-Biotin Conjugated

Gene Symbol:
CAPNS1
Official Gene Full Name:
Calpain, small subunit 1
NCBI Gene Id:
826
Protein Name:
Calpain small subunit 1
Swissprot Id:
P04632
Protein Accession #:
NP_001003962
Nucleotide Accession #:
NM_001003962
Alias Symbols:
30K, CALPAIN4, CANP, CANPS, CAPN4, CDPS, CSS1
Replacement Item:
This antibody may replace item sc-29887 from Santa Cruz Biotechnology.
Description of Target:
Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes. This gene encodes a small subunit common to both calpain I and II and is associated with myotonic dystrophy. Two transcript variants encoding the same protein have been identified for this gene.
Protein Size (# AA):
268
Molecular Weight:
29kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CAPNS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CAPNS1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CAPNS1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-CAPNS1 (ARP58434_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
AGTRAP; HUWE1; NEDD1; TUBGCP2; TUBGCP3; CDC20; UBC; OGFOD1; STK26; ISOC1; DCPS; MAT2B; PROSC; FERMT2; YWHAQ; PDIA4; YWHAZ; YWHAH; YWHAG; YWHAE; PTMA; PPP1CA; PAK2; PAFAH1B1; MYO1E; MAT2A; GNAI3; GAPDH; EIF5; TBCB; ALDH7A1; ASNS; APEX1; ADRB2; PPARGC1A; VC
Blocking Peptide:
For anti-CAPNS1 (ARP58434_P050) antibody is Catalog # AAP58434 (Previous Catalog # AAPP34805)
Datasheets/Manuals:
Printable datasheet for anti-CAPNS1 (ARP58434_P050) antibody
Subunit:
1
Publications:

Kulkarni, Y. M. et al. Differential proteomic analysis of caveolin-1 KO cells reveals Sh2b3 and Clec12b as novel interaction partners of caveolin-1 and Capns1 as a potential mediator of caveolin-1-induced apoptosis. Analyst 138, 6986-96 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 24091439

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...