Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP79708_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

CAPN6 Antibody - middle region (ARP79708_P050)

Catalog#: ARP79708_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CAPN6
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: TIPNHKEQEWDPQKTEKYAGIFHFRFWHFGEWTEVVIDDLLPTINGDLVF
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CAPN6 (ARP79708_P050) antibody is Catalog # AAP79708
Datasheets/ManualsPrintable datasheet for anti-CAPN6 (ARP79708_P050) antibody
Gene SymbolCAPN6
Official Gene Full Namecalpain 6
Alias SymbolsCANPX, CAPNX, CalpM, DJ914P14.1
NCBI Gene Id827
Protein Namecalpain-6
Description of TargetCalpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is highly expressed in the placenta. Its C-terminal region lacks any homology to the calmodulin-like domain of other calpains. The protein lacks critical active site residues and thus is suggested to be proteolytically inactive. The protein may play a role in tumor formation by inhibiting apoptosis and promoting angiogenesis.
Swissprot IdQ9Y6Q1
Protein Accession #NP_055104.2
Nucleotide Accession #NM_014289.3
Protein Size (# AA)641
Molecular Weight75 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CAPN6.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CAPN6.
Write Your Own Review
You're reviewing:CAPN6 Antibody - middle region (ARP79708_P050)
Your Rating
Aviva Live Chat
Aviva Blast Tool
Aviva Travel Grant
Aviva Tips and Tricks