Search Antibody, Protein, and ELISA Kit Solutions

CAPN6 Antibody - middle region (ARP79708_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
CAPN6
Official Gene Full Name:
calpain 6
NCBI Gene Id:
827
Protein Name:
calpain-6
Swissprot Id:
Q9Y6Q1
Protein Accession #:
NP_055104.2
Nucleotide Accession #:
NM_014289.3
Alias Symbols:
CANPX, CAPNX, CalpM, DJ914P14.1
Description of Target:
Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is highly expressed in the placenta. Its C-terminal region lacks any homology to the calmodulin-like domain of other calpains. The protein lacks critical active site residues and thus is suggested to be proteolytically inactive. The protein may play a role in tumor formation by inhibiting apoptosis and promoting angiogenesis.
Protein Size (# AA):
641
Molecular Weight:
75 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CAPN6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CAPN6.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CAPN6
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: TIPNHKEQEWDPQKTEKYAGIFHFRFWHFGEWTEVVIDDLLPTINGDLVF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CAPN6 (ARP79708_P050) antibody is Catalog # AAP79708
Datasheets/Manuals:
Printable datasheet for anti-CAPN6 (ARP79708_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...