CAP1 Antibody - middle region (ARP89525_P050)

Catalog No: ARP89525_P050

Host: Rabbit
Target Name: CAP1
Sample Tissue: Mouse Thymus lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse CAP1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKPATK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CAP1 (ARP89525_P050) antibody is Catalog # AAP89525

Target Info

• Gene Symbol: CAP1
• Gene Full Name: CAP, adenylate cyclase-associated protein 1 (yeast)
• NCBI Gene Id: 12331
• Protein Name: adenylyl cyclase-associated protein 1
• Description of Target: The product of this gene plays a role in regulating actin dynamics by binding actin monomers and promoting the turnover of actin filaments. Reduced expression of this gene causes a reduction in actin filament turnover rates, causing multiple defects, including an increase in cell size, stress-fiber alterations, and defects in endocytosis and cell motility. A pseudogene of this gene is found on chromosome 14. Alternative splicing results in multiple transcript variants, but does not affect the protein.
• Uniprot ID: P40124
• Protein Accession #: NP_001287996.1
• Nucleotide Accession #: NM_001301067.1
• Protein Size (# AA): 474
• Molecular Weight: 52 kDa