SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP53184_P050
Price: $0.00
SKU
ARP53184_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CAMKK2 (ARP53184_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CAMKK2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 86%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM
Concentration0.5 mg/ml
Blocking PeptideFor anti-CAMKK2 (ARP53184_P050) antibody is Catalog # AAP53184 (Previous Catalog # AAPP36322)
Sample Type Confirmation

There is BioGPS gene expression data showing that CAMKK2 is expressed in 721_B, Hela, HepG2

CAMKK2 is supported by BioGPS gene expression data to be expressed in Jurkat, MCF7

ReferenceErhardt,A., J Affect Disord 101 (1-3), 159-168 (2007)
Gene SymbolCAMKK2
Gene Full NameCalcium/calmodulin-dependent protein kinase kinase 2, beta
Alias SymbolsCAMKK, CAMKKB
NCBI Gene Id10645
Protein NameCalcium/calmodulin-dependent protein kinase kinase 2
Description of TargetCAMKK2 is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. CAMKK2 seems to be involved in hippocampal activation of CREB1.The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases.
Uniprot IDQ96RR4
Protein Accession #NP_705720
Nucleotide Accession #NM_153500
Protein Size (# AA)498
Molecular Weight55kDa
Protein InteractionsHSP90AA1; APP; UBC; NEDD4; CEP63; ESYT2; FANCI; OBSL1; ATG4B; XPOT; GCN1L1; IQGAP2; SMC3; SLC25A11; SMC1A; PRKDC; PRKAG1; PRKAA2; IRAK1; FLNC; FLNA; MAPK14; CALM1; CAMK4; CAMK1; PRKACA; SGK1;
  1. What is the species homology for "CAMKK2 Antibody - N-terminal region (ARP53184_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "CAMKK2 Antibody - N-terminal region (ARP53184_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CAMKK2 Antibody - N-terminal region (ARP53184_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CAMKK2 Antibody - N-terminal region (ARP53184_P050)"?

    This target may also be called "CAMKK, CAMKKB" in publications.

  5. What is the shipping cost for "CAMKK2 Antibody - N-terminal region (ARP53184_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CAMKK2 Antibody - N-terminal region (ARP53184_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CAMKK2 Antibody - N-terminal region (ARP53184_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CAMKK2 Antibody - N-terminal region (ARP53184_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CAMKK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CAMKK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CAMKK2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CAMKK2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CAMKK2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CAMKK2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CAMKK2 Antibody - N-terminal region (ARP53184_P050)
Your Rating
We found other products you might like!