CaMK4 Antibody (Phospho-Thr196/200) (OAAF07527)

Catalog No: OAAF07527 (Formerly GWB-ASB363)

Size:100 ug

Western blot analysis of lysates from K562 cells treated with H2O2 100uM 30', using CaMK4 (Phospho-Thr196/200) Antibody. The lane on the right is blocked with the phospho peptide.

Immunohistochemistry analysis of paraffin-embedded human brain, using CaMK4 (Phospho-Thr196/200) Antibody. The picture on the right is blocked with the phospho peptide.

Immunofluorescence analysis of HeLa cells, using CaMK4 (Phospho-Thr196/200) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Product Format: Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Clonality: Polyclonal
• Isotype: IgG
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Additional Information: Modification Sites: Human:T200 Mouse:T196 Rat:T196
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human CaMK4 around the phosphorylation site of Thr196/200.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: KPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRG
• Concentration: 1mg/ml
• Target Post-Translational Modification: Phospho
• Specificity: CaMK4 (Phospho-Thr196/200) Antibody detects endogenous levels of CaMK4 only when phosphorylated at Thr196/200.
• Application Info: WB: 1:500~1000
  IHC: 1:50~100
  IF: 1:100~500
  ELISA: 1:40000

Target Info

• Gene Symbol: CAMK4
• Gene Full Name: calcium/calmodulin dependent protein kinase IV
• Alias Symbols: brain Ca(2+)-calmodulin-dependent protein kinase type IV;brain Ca++-calmodulin-dependent protein kinase type IV;calcium/calmodulin-dependent protein kinase type IV;calcium/calmodulin-dependent protein kinase type IV catalytic chain;CAM kinase- GR;CAM kinase IV;CaM kinase-GR;caMK;CaMK IV;CaMK-GR;CaMKIV.
• NCBI Gene Id: 814
• Protein Name: Calcium/calmodulin-dependent protein kinase type IV
• Description of Target: Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK4 signaling cascade and regulates, mainly by phosphorylation, the activity of several transcription activators, such as CREB1, MEF2D, JUN and RORA, which play pivotal roles in immune response, inflammation, and memory consolidation. In the thymus, regulates the CD4(+)/CD8(+) double positive thymocytes selection threshold during T-cell ontogeny. In CD4 memory T-cells, is required to link T-cell antigen receptor (TCR) signaling to the production of IL2, IFNG and IL4 (through the regulation of CREB and MEF2). Regulates the differentiation and survival phases of osteoclasts and dendritic cells (DCs). Mediates DCs survival by linking TLR4 and the regulation of temporal expression of BCL2. Phosphorylates the transcription activator CREB1 on 'Ser-133' in hippocampal neuron nuclei and contribute to memory consolidation and long term potentiation (LTP) in the hippocampus. Can activate the MAP kinases MAPK1/ERK2, MAPK8/JNK1 and MAPK14/p38 and stimulate transcription through the phosphorylation of ELK1 and ATF2. Can also phosphorylate in vitro CREBBP, PRM2, MEF2A and STMN1/OP18.
• Uniprot ID: Q16566
• Molecular Weight: 51 kDa