Camk2b Antibody - middle region (ARP55353_P050)

Catalog No: ARP55353_P050

Host: Rabbit
Target Name: Camk2b
Sample Type: Rat Thymus lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Camk2b
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 93%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Camk2b (ARP55353_P050) antibody is Catalog # AAP55353
• Subunit: beta

Target Info

• Gene Symbol: Camk2b
• Alias Symbols: Ck2b
• NCBI Gene Id: 24245
• Protein Name: Calcium/calmodulin-dependent protein kinase II, beta 3 isoform EMBL CAA58289.1
• Description of Target: Camk2b is a beta subunit of calcium/calmodulin-dependent protein kinase II; It may be involved in retinal development,
• Uniprot ID: Q63094
• Protein Accession #: NP_001035813
• Nucleotide Accession #: NM_001042354
• Protein Size (# AA): 589
• Molecular Weight: 64kDa
• Protein Interactions: STXBP5L; Tubg1; Pcm1; Cdc20; Ywhae; Dact1; Dact2;