CALR Antibody - C-terminal region : FITC (ARP30114_P050-FITC)

Catalog No: ARP30114_p050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB, IHC
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CALR
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 92%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: FGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CALR (ARP30114_P050-FITC) antibody is Catalog # AAP30114 (Previous Catalog # AAPH00290)
• Sample Type Confirmation:

  CALR is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Urade,R., et al., (2004) Biochemistry 43 (27), 8858-8868

Target Info

• Gene Symbol: CALR
• Gene Full Name: Calreticulin
• Alias Symbols: RO, CRT, SSA, cC1qR, HEL-S-99n
• NCBI Gene Id: 811
• Protein Name: Calreticulin
• Description of Target: Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum. It is also found in the nucleus, suggesting that it may have a role in transcription regulation. Calreticulin binds to the synthetic peptide KLGFFKR, which is almost identical to an amino acid sequence in the DNA-binding domain of the superfamily of nuclear receptors. Calreticulin binds to antibodies in certain sera of systemic lupus and Sjogren patients which contain anti-Ro/SSA antibodies, it is highly conserved among species, and it is located in the endoplasmic and sarcoplasmic reticulum where it may bind calcium.
• Uniprot ID: P27797
• Protein Accession #: NP_004334
• Nucleotide Accession #: NM_004343
• Protein Size (# AA): 417
• Molecular Weight: 48kDa
• Protein Interactions: HUWE1; UBC; LGR4; MDM2; RNF2; SUZ12; rev; AARSD1; THG1L; NSUN2; SH3GLB1; EEF2K; ARPC1A; ANP32B; ACTR2; ARPC1B; ARPC3; ARPC5; TPD52L2; SH3GL1; RPA3; RPA1; PRKACA; PFDN5; LPP; PARK2; UPF2; UBD; SOX2; PDIA3; CLN5; ITGA3; HLA-E; HLA-A; CALR; SLC27A2; env; MTN