Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30114_P050-FITC Conjugated

ARP30114_P050-HRP Conjugated

ARP30114_P050-Biotin Conjugated

CALR Antibody - C-terminal region (ARP30114_P050)

Catalog#: ARP30114_p050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-6467 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CALR
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 92%; Zebrafish: 79%
Complete computational species homology data Anti-CALR (ARP30114_P050)
Peptide Sequence Synthetic peptide located within the following region: FGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-CALR (ARP30114_P050) antibody is Catalog # AAP30114 (Previous Catalog # AAPH00290)
Datasheets/Manuals Printable datasheet for anti-CALR (ARP30114_P050) antibody
Sample Type Confirmation

CALR is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Urade,R., et al., (2004) Biochemistry 43 (27), 8858-8868

Taguchi, A; Rho, JH; Yan, Q; Zhang, Y; Zhao, Y; Xu, H; Tripathi, SC; Wang, H; Brenner, DE; Kucherlapati, M; Kucherlapati, R; Boutin, AT; Wang, YA; DePinho, RA; Feng, Z; Lampe, PD; Hanash, SM; MAPRE1 as a plasma biomarker for early-stage colorectal cancer and adenomas. 8, 1112-9 (2015). WB, IHC, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 26342024

Gene Symbol CALR
Official Gene Full Name Calreticulin
Alias Symbols RO, CRT, SSA, cC1qR
NCBI Gene Id 811
Protein Name Calreticulin
Description of Target Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum. It is also found in the nucleus, suggesting that it may have a role in transcription regulation. Calreticulin binds to the synthetic peptide KLGFFKR, which is almost identical to an amino acid sequence in the DNA-binding domain of the superfamily of nuclear receptors. Calreticulin binds to antibodies in certain sera of systemic lupus and Sjogren patients which contain anti-Ro/SSA antibodies, it is highly conserved among species, and it is located in the endoplasmic and sarcoplasmic reticulum where it may bind calcium.
Swissprot Id P27797
Protein Accession # NP_004334
Nucleotide Accession # NM_004343
Protein Size (# AA) 417
Molecular Weight 48kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CALR.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CALR.
Write Your Own Review
You're reviewing:CALR Antibody - C-terminal region (ARP30114_P050)
Your Rating