Search Antibody, Protein, and ELISA Kit Solutions

CALR Antibody - C-terminal region (ARP30114_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP30114_P050-FITC Conjugated

ARP30114_P050-HRP Conjugated

ARP30114_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-6467 from Santa Cruz Biotechnology.
Description of Target:
Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum. It is also found in the nucleus, suggesting that it may have a role in transcription regulation. Calreticulin binds to the synthetic peptide KLGFFKR, which is almost identical to an amino acid sequence in the DNA-binding domain of the superfamily of nuclear receptors. Calreticulin binds to antibodies in certain sera of systemic lupus and Sjogren patients which contain anti-Ro/SSA antibodies, it is highly conserved among species, and it is located in the endoplasmic and sarcoplasmic reticulum where it may bind calcium.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CALR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CALR.
The immunogen is a synthetic peptide directed towards the C terminal region of human CALR
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 92%; Zebrafish: 79%
Complete computational species homology data:
Anti-CALR (ARP30114_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDK
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CALR (ARP30114_P050) antibody is Catalog # AAP30114 (Previous Catalog # AAPH00290)
Printable datasheet for anti-CALR (ARP30114_P050) antibody
Sample Type Confirmation:

CALR is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Urade,R., et al., (2004) Biochemistry 43 (27), 8858-8868

Taguchi, A; Rho, JH; Yan, Q; Zhang, Y; Zhao, Y; Xu, H; Tripathi, SC; Wang, H; Brenner, DE; Kucherlapati, M; Kucherlapati, R; Boutin, AT; Wang, YA; DePinho, RA; Feng, Z; Lampe, PD; Hanash, SM; MAPRE1 as a plasma biomarker for early-stage colorectal cancer and adenomas. 8, 1112-9 (2015). WB, IHC, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 26342024

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...