SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP42260_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP42260_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CALCRL Antibody - N-terminal region : HRP (ARP42260_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-CALCRL (ARP42260_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CALCRL
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90%
Peptide SequenceSynthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CALCRL (ARP42260_P050-HRP) antibody is Catalog # AAP42260 (Previous Catalog # AAPP24681)
ReferenceEskesen,K., Ideggyogy Sz 60 (11-12), 459-466 (2007)
Gene SymbolCALCRL
Gene Full NameCalcitonin receptor-like
Alias SymbolsCRLR, CGRPR, LMPHM8
NCBI Gene Id10203
Protein NameCalcitonin gene-related peptide type 1 receptor
Description of TargetCALCRL is the receptor for calcitonin-gene-related peptide (CGRP) together with RAMP1 and receptor for adrenomedullin together with RAMP2 or RAMP3. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Uniprot IDQ16602
Protein Accession #NP_005786
Nucleotide Accession #NM_005795
Protein Size (# AA)461
Molecular Weight53kDa
Protein InteractionsCALCA; CRCP; RAMP3; RAMP2; RAMP1; ADM;
  1. What is the species homology for "CALCRL Antibody - N-terminal region : HRP (ARP42260_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "CALCRL Antibody - N-terminal region : HRP (ARP42260_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CALCRL Antibody - N-terminal region : HRP (ARP42260_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CALCRL Antibody - N-terminal region : HRP (ARP42260_P050-HRP)"?

    This target may also be called "CRLR, CGRPR, LMPHM8" in publications.

  5. What is the shipping cost for "CALCRL Antibody - N-terminal region : HRP (ARP42260_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CALCRL Antibody - N-terminal region : HRP (ARP42260_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CALCRL Antibody - N-terminal region : HRP (ARP42260_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CALCRL Antibody - N-terminal region : HRP (ARP42260_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CALCRL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CALCRL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CALCRL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CALCRL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CALCRL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CALCRL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CALCRL Antibody - N-terminal region : HRP (ARP42260_P050-HRP)
Your Rating
We found other products you might like!