Search Antibody, Protein, and ELISA Kit Solutions

CACYBP Antibody - middle region (ARP51259_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51259_T100-FITC Conjugated

ARP51259_T100-HRP Conjugated

ARP51259_T100-Biotin Conjugated

Gene Symbol:
CACYBP
Official Gene Full Name:
Calcyclin binding protein
NCBI Gene Id:
27101
Protein Name:
Calcyclin-binding protein
Swissprot Id:
Q9HB71
Protein Accession #:
NP_055227
Nucleotide Accession #:
NM_014412
Alias Symbols:
GIG5, MGC87971, PNAS-107, RP1-102G20.6, S100A6BP, SIP
Replacement Item:
This antibody may replace item sc-166163 from Santa Cruz Biotechnology.
Description of Target:
CACYBP is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin.The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
228
Molecular Weight:
26kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CACYBP
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
ARP51259_T100
Peptide Sequence:
Synthetic peptide located within the following region: FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CTNNB1; HSP90AB1; FKBP5; FKBP4; RPAP3; FKBP8; SUGT1; CARM1; RNF41; IRS4; UBE2I; PRDX2; PRDX1; METTL1; AARS; IPO11; TPD52; PPP6R2; PINX1; NGFRAP1; VCAM1; UBC; ITGA4; FN1; CD8A; SIAH1; HSP90AA1; TP53BP1; HNRNPA0; CACYBP; SKP1; S100A6; MAPK1; Mapk13; STK3; O
Blocking Peptide:
Catalog # AAP51259 (Previous Catalog # AAPP28407)
Datasheets/Manuals:
Printable datasheet for ARP51259_T100
Target Reference:
Santelli,E., (2005) J. Biol. Chem. 280 (40), 34278-34287

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...