Search Antibody, Protein, and ELISA Kit Solutions

CACNA1G Antibody - C - terminal region (ARP35566_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35566_P050-FITC Conjugated

ARP35566_P050-HRP Conjugated

ARP35566_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-16259 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human CACNA1G
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-CACNA1G (ARP35566_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CACNA1G (ARP35566_P050) antibody is Catalog # AAP35566 (Previous Catalog # AAPP06810)
Datasheets/Manuals:
Printable datasheet for anti-CACNA1G (ARP35566_P050) antibody
Subunit:
alpha-1G
Target Reference:
Ogino,S., (2007) J Mol Diagn 9 (3), 305-314
Gene Symbol:
CACNA1G
Official Gene Full Name:
Calcium channel, voltage-dependent, T type, alpha 1G subunit
Alias Symbols:
Ca(V)T.1, Cav3.1, MGC117234, NBR13
NCBI Gene Id:
8913
Protein Name:
Voltage-dependent T-type calcium channel subunit alpha-1G
Description of Target:
Voltage-activated calcium channels can be distinguished based on their voltage-dependence, deactivation, and single-channel conductance. See MIM 601011. Low-voltage-activated calcium channels are referred to as 'T' type because their currents are both tra
Swissprot Id:
O43497
Protein Accession #:
NP_938202
Nucleotide Accession #:
NM_198388
Protein Size (# AA):
2171
Molecular Weight:
241kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CACNA1G.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CACNA1G.
Protein Interactions:
RANBP9; UBQLN4;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...