Search Antibody, Protein, and ELISA Kit Solutions

CA4 Antibody - C-terminal region (ARP41422_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41422_P050-FITC Conjugated

ARP41422_P050-HRP Conjugated

ARP41422_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Carbonic anhydrase IV
NCBI Gene Id:
Protein Name:
Carbonic anhydrase 4
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CAIV, Car4, RP17
Replacement Item:
This antibody may replace item sc-17247 from Santa Cruz Biotechnology.
Description of Target:
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CA4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CA4.
The immunogen is a synthetic peptide directed towards the C terminal region of human CA4
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 83%; Guinea Pig: 92%; Horse: 83%; Human: 100%; Mouse: 85%; Rabbit: 85%; Rat: 85%
Complete computational species homology data:
Anti-CA4 (ARP41422_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PIH1D1; PRDX2; Htt; SLC4A4; SLC4A1; SLC4A3;
Blocking Peptide:
For anti-CA4 (ARP41422_P050) antibody is Catalog # AAP41422 (Previous Catalog # AAPP24160)
Printable datasheet for anti-CA4 (ARP41422_P050) antibody
Target Reference:
Yang,Z., (2005) Hum. Mol. Genet. 14 (2), 255-265

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...