Catalog No: OPCA01215
Price: $0.00
SKU
OPCA01215
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for CA1 Recombinant Protein (Rat) (OPCA01215) (OPCA01215) |
---|
Predicted Species Reactivity | Rat|Rattus norvegicus |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Tag information : His tag |
Reconstitution and Storage | -20°C or -80°C |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF |
Protein Sequence | ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | Yeast |
Protein Range | 2-261 aa |
Tag | N-terminal 6xHis-tagged |
Reference | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Proteome profile of the mature rat olfactory bulb.Maurya D.K., Sundaram C.S., Bhargava P.Proteomics 9:2593-2599(2009) |
---|---|
Gene Symbol | Car1 |
Gene Full Name | carbonic anhydrase 1 |
Alias Symbols | Ca1;CA-I;Carbonate dehydratase I;carbonic anhydrase 1;carbonic anhydrase I. |
NCBI Gene Id | 310218 |
Protein Name | Carbonic anhydrase 1 |
Description of Target | Reversible hydration of carbon dioxide. |
Uniprot ID | B0BNN3 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 30.2 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review