Search Antibody, Protein, and ELISA Kit Solutions

C6orf134 Antibody - N-terminal region (ARP42641_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42641_P050-FITC Conjugated

ARP42641_P050-HRP Conjugated

ARP42641_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Alpha tubulin acetyltransferase 1
NCBI Gene Id:
Protein Name:
Alpha-tubulin N-acetyltransferase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp547J097, FLJ13158, Nbla00487, TAT, MEC17, C6orf134
Description of Target:
The exact function of C6orf134 remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C6orf134.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C6orf134.
The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf134
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-C6orf134 (ARP42641_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ATAT1 (ARP42641_P050) antibody is Catalog # AAP42641 (Previous Catalog # AAPP11569)
Printable datasheet for anti-ATAT1 (ARP42641_P050) antibody

Kalebic, N. et al. Tubulin acetyltransferase -alphaTAT1 destabilizes microtubules independently of its acetylation activity. Mol. Cell. Biol. 33, 1114-23 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23275437

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...