Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP42641_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42641_P050-FITC Conjugated

ARP42641_P050-HRP Conjugated

ARP42641_P050-Biotin Conjugated

C6orf134 Antibody - N-terminal region (ARP42641_P050)

Catalog#: ARP42641_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human C6orf134
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-C6orf134 (ARP42641_P050)
Peptide SequenceSynthetic peptide located within the following region: MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ATAT1 (ARP42641_P050) antibody is Catalog # AAP42641 (Previous Catalog # AAPP11569)
Datasheets/ManualsPrintable datasheet for anti-ATAT1 (ARP42641_P050) antibody
Publications

Kalebic, N. et al. Tubulin acetyltransferase -alphaTAT1 destabilizes microtubules independently of its acetylation activity. Mol. Cell. Biol. 33, 1114-23 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23275437

Gene SymbolATAT1
Official Gene Full NameAlpha tubulin acetyltransferase 1
Alias SymbolsDKFZp547J097, FLJ13158, Nbla00487, TAT, MEC17, C6orf134
NCBI Gene Id79969
Protein NameAlpha-tubulin N-acetyltransferase
Description of TargetThe exact function of C6orf134 remains unknown.
Swissprot IdQ5SQI0
Protein Accession #NP_079185
Nucleotide Accession #NM_024909
Protein Size (# AA)323
Molecular Weight36kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express C6orf134.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express C6orf134.
Protein InteractionsSRPK2; APP;
Write Your Own Review
You're reviewing:C6orf134 Antibody - N-terminal region (ARP42641_P050)
Your Rating
Aviva Pathways
Aviva Blast Tool
Aviva ChIP Antibodies
Aviva Validation Data