Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

C6orf120 Antibody - N-terminal region : FITC (ARP69743_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP69743_P050 Unconjugated

ARP69743_P050-HRP Conjugated

ARP69743_P050-Biotin Conjugated

Gene Symbol:
C6orf120
NCBI Gene Id:
387263
Swissprot Id:
Q7Z4R8
Protein Accession #:
NP_001025034
Alias Symbols:
C6orf120,
Replacement Item:
This antibody may replace item sc-240140 from Santa Cruz Biotechnology.
Description of Target:
C6orf120 may be involved in induction of apoptosis in CD4(+) T- cells, but not CD8(+) T-cells or hepatocytes.
Protein Size (# AA):
191
Molecular Weight:
21kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C6orf120.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C6orf120.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human C6orf120
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LLLLASQVLSPGSCADEEEVPEEWVLLHVVQGQIGAGNYSYLRLNHEGKI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Blocking Peptide:
For anti-C6orf120 (ARP69743_P050-FITC) antibody is Catalog # AAP69743
Datasheets/Manuals:
Printable datasheet for anti-C6orf120 (ARP69743_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...