Search Antibody, Protein, and ELISA Kit Solutions

GPR77 Antibody - C-terminal region (ARP83601_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
GPR77
Official Gene Full Name:
complement component 5a receptor 2
NCBI Gene Id:
27202
Protein Name:
C5a anaphylatoxin chemotactic receptor 2
Swissprot Id:
Q9P296
Protein Accession #:
NP_001258678.1
Nucleotide Accession #:
NM_001271749.1
Alias Symbols:
C5L2, GPF77, GPR77
Description of Target:
This gene encodes a G-protein coupled receptor 1 family member involved in the complement system of the innate immune response. Unlike classical G-protein coupled receptors, the encoded protein does not associate with intracellular G-proteins. It may instead modulate signal transduction through the beta-arrestin pathway, and may alternatively act as a decoy receptor. This gene may be involved in coronary artery disease and in the pathogenesis of sepsis. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
337
Molecular Weight:
37 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GPR77.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GPR77.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human GPR77
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: CLNPMLFLYFGRAQLRRSLPAACHWALRESQGQDESVDSKKSTSHDLVSE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GPR77 (ARP83601_P050) antibody is Catalog # AAP83601
Datasheets/Manuals:
Printable datasheet for anti-GPR77 (ARP83601_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...