Search Antibody, Protein, and ELISA Kit Solutions

C3AR1 Antibody - N-terminal region : FITC (ARP75960_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75960_P050 Unconjugated

ARP75960_P050-HRP Conjugated

ARP75960_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
C3AR1
Official Gene Full Name:
complement C3a receptor 1
NCBI Gene Id:
719
Protein Name:
C3a anaphylatoxin chemotactic receptor
Swissprot Id:
Q16581
Protein Accession #:
NP_004045
Alias Symbols:
AZ3B, C3AR, HNFAG09
Description of Target:
C3a is an anaphylatoxin released during activation of the complement system. The protein encoded by this gene is an orphan G protein-coupled receptor for C3a. Binding of C3a by the encoded receptor activates chemotaxis, granule enzyme release, superoxide anion production, and bacterial opsonization.
Protein Size (# AA):
482
Molecular Weight:
53kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C3AR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C3AR1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human C3AR
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: ASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Blocking Peptide:
For anti-C3AR1 (ARP75960_P050-FITC) antibody is Catalog # AAP75960
Datasheets/Manuals:
Printable datasheet for anti-C3AR1 (ARP75960_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...