SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP58090_P050
Price: $0.00
SKU
ARP58090_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-GCFC2 (ARP58090_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human C2orf3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 100%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 85%; Rabbit: 83%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: SEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-GCFC2 (ARP58090_P050) antibody is Catalog # AAP58090 (Previous Catalog # AAPP32523)
Sample Type Confirmation

GCFC2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceAnthoni,H., (2007) Hum. Mol. Genet. 16 (6), 667-677
Gene SymbolGCFC2
Gene Full NameGC-rich sequence DNA-binding factor 2
Alias SymbolsGCF, TCF9, DNABF, C2orf3
NCBI Gene Id6936
Protein NameGC-rich sequence DNA-binding factor 2
Description of TargetThe first mRNA transcript isolated for C2orf3 gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). C2orf3 belongs to the GCF family. It is a factor that represses transcription. It binds to the GC-rich sequences (5'-GCGGGGC-3') present in the epidermal growth factor receptor, beta-actin, and calcium-dependent protease promoters.The first mRNA transcript isolated for this gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). A positively charged amino terminus present only in the chimera was determined to bind GC-rich DNA, thus mistakenly thought to identify a transcription factor gene.
Uniprot IDP16383
Protein Accession #NP_003194
Nucleotide Accession #NM_003203
Protein Size (# AA)781
Molecular Weight89kDa
Protein InteractionsHDAC11; CREB3L2; ATXN1; SUMO2;
  1. What is the species homology for "C2orf3 Antibody - N-terminal region (ARP58090_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "C2orf3 Antibody - N-terminal region (ARP58090_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "C2orf3 Antibody - N-terminal region (ARP58090_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "C2orf3 Antibody - N-terminal region (ARP58090_P050)"?

    This target may also be called "GCF, TCF9, DNABF, C2orf3" in publications.

  5. What is the shipping cost for "C2orf3 Antibody - N-terminal region (ARP58090_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "C2orf3 Antibody - N-terminal region (ARP58090_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C2orf3 Antibody - N-terminal region (ARP58090_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "89kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C2orf3 Antibody - N-terminal region (ARP58090_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "GCFC2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "GCFC2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "GCFC2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "GCFC2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "GCFC2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "GCFC2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:C2orf3 Antibody - N-terminal region (ARP58090_P050)
Your Rating
We found other products you might like!