C2orf3 Antibody - N-terminal region (ARP58090_P050)

Catalog No: ARP58090_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-C2orf3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Lung

Host: Rabbit
Target Name: GCFC2
Sample Type: Jurkat
Antibody Dilution: 1.0ug/mlGCFC2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Host: Rabbit
Target Name: GCFC2
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 100%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 85%; Rabbit: 83%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: SEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-GCFC2 (ARP58090_P050) antibody is Catalog # AAP58090 (Previous Catalog # AAPP32523)
• Sample Type Confirmation:

  GCFC2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Anthoni,H., (2007) Hum. Mol. Genet. 16 (6), 667-677

Target Info

• Gene Symbol: GCFC2
• Gene Full Name: GC-rich sequence DNA-binding factor 2
• Alias Symbols: GCF, TCF9, DNABF, C2orf3
• NCBI Gene Id: 6936
• Protein Name: GC-rich sequence DNA-binding factor 2
• Description of Target: The first mRNA transcript isolated for C2orf3 gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). C2orf3 belongs to the GCF family. It is a factor that represses transcription. It binds to the GC-rich sequences (5'-GCGGGGC-3') present in the epidermal growth factor receptor, beta-actin, and calcium-dependent protease promoters.The first mRNA transcript isolated for this gene was part of an artificial chimera derived from two distinct gene transcripts and a primer used in the cloning process (see Genbank accession M29204). A positively charged amino terminus present only in the chimera was determined to bind GC-rich DNA, thus mistakenly thought to identify a transcription factor gene.
• Uniprot ID: P16383
• Protein Accession #: NP_003194
• Nucleotide Accession #: NM_003203
• Protein Size (# AA): 781
• Molecular Weight: 89kDa
• Protein Interactions: HDAC11; CREB3L2; ATXN1; SUMO2;