C2orf29 Antibody - middle region (ARP56972_P050)

Catalog No: ARP56972_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-C2orf29 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C2orf29
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CNOT11 (ARP56972_P050) antibody is Catalog # AAP56972 (Previous Catalog # AAPP39916)

Target Info

• Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731
• Gene Symbol: CNOT11
• Gene Full Name: Chromosome 2 open reading frame 29
• Alias Symbols: C40, C2orf29
• NCBI Gene Id: 55571
• Protein Name: UPF0760 protein C2orf29
• Description of Target: The function of this protein remains unknown.
• Uniprot ID: Q9UKZ1
• Protein Accession #: NP_060016
• Nucleotide Accession #: NM_017546
• Protein Size (# AA): 510
• Molecular Weight: 55kDa
• Protein Interactions: UBC; NLK; ELAVL1; Cnot3;