Now Offering Over 102,157 Antibodies & 44,722 Antigens!

C22orf28 antibody - N-terminal region (ARP56745_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock

Conjugation Options

ARP56745_P050-FITC Conjugated

ARP56745_P050-HRP Conjugated

ARP56745_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
RTCB
NCBI Gene Id:
51493
Official Gene Full Name:
Chromosome 22 open reading frame 28
Protein Name:
tRNA-splicing ligase RtcB homolog
Swissprot Id:
Q9Y3I0
Protein Accession #:
NP_055121
Nucleotide Accession #:
NM_014306
Alias Symbols:
DJ149A16.6, HSPC117, RP1-149A16.6, C22orf28
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
505
Molecular Weight:
55kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C22orf28.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C22orf28.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human C22orf28
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-C22orf28 (ARP56745_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; FUS; SUMO1; NEDD8; MDM2; BMI1; rev; HNRNPM; MRE11A; KRT18; ILF2; FLII; DHX9; DDX1; ABCF1; C14orf166; RPL26L1; IGF2BP3; POLR1C; LRRFIP1; EIF2B2; EIF2B3; YBX3; RPL27; RFC4; RFC2; QARS; PRKDC; NMT1; AICDA; FN1; CA9; FAM98B; C2orf49; CAND1; COPS5; CUL1;
Blocking Peptide:
For anti-RTCB (ARP56745_P050) antibody is Catalog # AAP56745 (Previous Catalog # AAPP39603)
Datasheets/Manuals:
Printable datasheet for anti-RTCB (ARP56745_P050) antibody
Sample Type Confirmation:

RTCB is supported by BioGPS gene expression data to be expressed in HeLa, Jurkat

Target Reference:
Guo,D., (2005) Biochem. Biophys. Res. Commun. 337 (4), 1308-1318

Tell us what you think about this item!

Write A Review
    Please, wait...