Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP56745_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP56745_P050-FITC Conjugated

ARP56745_P050-HRP Conjugated

ARP56745_P050-Biotin Conjugated

C22orf28 Antibody - N-terminal region (ARP56745_P050)

Catalog#: ARP56745_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human C22orf28
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology dataAnti-C22orf28 (ARP56745_P050)
Peptide SequenceSynthetic peptide located within the following region: PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-RTCB (ARP56745_P050) antibody is Catalog # AAP56745 (Previous Catalog # AAPP39603)
Datasheets/ManualsPrintable datasheet for anti-RTCB (ARP56745_P050) antibody
Sample Type Confirmation

RTCB is supported by BioGPS gene expression data to be expressed in HeLa, Jurkat

Target ReferenceGuo,D., (2005) Biochem. Biophys. Res. Commun. 337 (4), 1308-1318
Gene SymbolRTCB
Official Gene Full NameChromosome 22 open reading frame 28
Alias SymbolsDJ149A16.6, HSPC117, RP1-149A16.6, C22orf28
NCBI Gene Id51493
Protein NametRNA-splicing ligase RtcB homolog
Description of TargetThe function of this protein remains unknown.
Swissprot IdQ9Y3I0
Protein Accession #NP_055121
Nucleotide Accession #NM_014306
Protein Size (# AA)505
Molecular Weight55kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express C22orf28.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express C22orf28.
Protein InteractionsUBC; FUS; SUMO1; NEDD8; MDM2; BMI1; rev; HNRNPM; MRE11A; KRT18; ILF2; FLII; DHX9; DDX1; ABCF1; C14orf166; RPL26L1; IGF2BP3; POLR1C; LRRFIP1; EIF2B2; EIF2B3; YBX3; RPL27; RFC4; RFC2; QARS; PRKDC; NMT1; AICDA; FN1; CA9; FAM98B; C2orf49; CAND1; COPS5; CUL1;
Write Your Own Review
You're reviewing:C22orf28 Antibody - N-terminal region (ARP56745_P050)
Your Rating
Aviva ChIP Antibodies
Aviva Pathways
Aviva Live Chat
Aviva HIS tag Deal