C21orf13 antibody - N-terminal region (ARP45912_P050)

Catalog#: ARP45912_P050

• Size: 100 ul

• Gene Symbol: LCA5L
• NCBI Gene Id: 150082
• Official Gene Full Name: Leber congenital amaurosis 5-like
• Protein Name: Lebercilin-like protein
• Swissprot Id: O95447
• Protein Accession #: NP_689718
• Nucleotide Accession #: NM_152505
• Alias Symbols: MGC33295, C21orf13
• Replacement Item: This antibody may replace item sc-146668 from Santa Cruz Biotechnology.
• Description of Target: The function of the C21orf13 protein remains unknown.
• Protein Size (# AA): 670
• Molecular Weight: 76kDa
• Host: Rabbit
• Clonality: Polyclonal
• Purification: Affinity Purified
• Application: WB
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express C21orf13.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf13
• Tested Species Reactivity: Human, Mouse
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Yeast: 75%
• Peptide Sequence: Synthetic peptide located within the following region: SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Protein Interactions: TFIP11; NMI; TPM3; SUV39H2;
• Blocking Peptide: For anti-LCA5L (ARP45912_P050) antibody is Catalog # AAP45912 (Previous Catalog # AAPS16510)
• Target Reference: den (2007) Nat. Genet. 39 (7), 889-895
• Publications:

  Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Human, Yeast 23103828

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: C21orf13 antibody tested with Human Mcf7 Cells (ARP45912_P050)