Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

C21orf13 Antibody - N-terminal region (ARP45912_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45912_P050-FITC Conjugated

ARP45912_P050-HRP Conjugated

ARP45912_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Leber congenital amaurosis 5-like
NCBI Gene Id:
Protein Name:
Lebercilin-like protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC33295, C21orf13
Replacement Item:
This antibody may replace item sc-146668 from Santa Cruz Biotechnology.
Description of Target:
The function of the C21orf13 protein remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C21orf13.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C21orf13.
The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf13
Predicted Species Reactivity:
Human, Yeast
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Yeast: 75%
Complete computational species homology data:
Anti-C21orf13 (ARP45912_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LCA5L (ARP45912_P050) antibody is Catalog # AAP45912 (Previous Catalog # AAPS16510)
Printable datasheet for anti-LCA5L (ARP45912_P050) antibody
Target Reference:
den (2007) Nat. Genet. 39 (7), 889-895

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Human, Yeast 23103828

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...