C21orf13 Antibody - N-terminal region (ARP45912_P050)

Catalog No: ARP45912_P050

WB Suggested Anti-C21orf13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate

WB Suggested Anti-C21orf13 Antibody Titration: 5% Milk
ELISA Titer: dilution: 1:500
Positive Control: Mouse Brain lysate

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf13
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Yeast: 75%
• Peptide Sequence: Synthetic peptide located within the following region: SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LCA5L (ARP45912_P050) antibody is Catalog # AAP45912 (Previous Catalog # AAPS16510)
• Reference: den (2007) Nat. Genet. 39 (7), 889-895
• Publications:

  Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828

Target Info

• Gene Symbol: LCA5L
• Gene Full Name: Leber congenital amaurosis 5-like
• Alias Symbols: C21orf13
• NCBI Gene Id: 150082
• Protein Name: Lebercilin-like protein
• Description of Target: The function of the C21orf13 protein remains unknown.
• Uniprot ID: O95447
• Protein Accession #: NP_689718
• Nucleotide Accession #: NM_152505
• Protein Size (# AA): 670
• Molecular Weight: 76kDa
• Protein Interactions: TFIP11; NMI; TPM3; SUV39H2;