Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45912_P050-FITC Conjugated

ARP45912_P050-HRP Conjugated

ARP45912_P050-Biotin Conjugated

C21orf13 Antibody - N-terminal region (ARP45912_P050)

Catalog#: ARP45912_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Human, Yeast
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-146668 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf13
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%; Yeast: 75%
Complete computational species homology data Anti-C21orf13 (ARP45912_P050)
Peptide Sequence Synthetic peptide located within the following region: SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LCA5L (ARP45912_P050) antibody is Catalog # AAP45912 (Previous Catalog # AAPS16510)
Datasheets/Manuals Printable datasheet for anti-LCA5L (ARP45912_P050) antibody
Target Reference den (2007) Nat. Genet. 39 (7), 889-895

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Human, Yeast 23103828

Gene Symbol LCA5L
Official Gene Full Name Leber congenital amaurosis 5-like
Alias Symbols MGC33295, C21orf13
NCBI Gene Id 150082
Protein Name Lebercilin-like protein
Description of Target The function of the C21orf13 protein remains unknown.
Swissprot Id O95447
Protein Accession # NP_689718
Nucleotide Accession # NM_152505
Protein Size (# AA) 670
Molecular Weight 76kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express C21orf13.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express C21orf13.
Protein Interactions TFIP11; NMI; TPM3; SUV39H2;
  1. What is the species homology for "C21orf13 Antibody - N-terminal region (ARP45912_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Yeast".

  2. How long will it take to receive "C21orf13 Antibody - N-terminal region (ARP45912_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "C21orf13 Antibody - N-terminal region (ARP45912_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "C21orf13 Antibody - N-terminal region (ARP45912_P050)"?

    This target may also be called "MGC33295, C21orf13" in publications.

  5. What is the shipping cost for "C21orf13 Antibody - N-terminal region (ARP45912_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "C21orf13 Antibody - N-terminal region (ARP45912_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C21orf13 Antibody - N-terminal region (ARP45912_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "76kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C21orf13 Antibody - N-terminal region (ARP45912_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LCA5L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LCA5L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LCA5L"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LCA5L"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LCA5L"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LCA5L"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:C21orf13 Antibody - N-terminal region (ARP45912_P050)
Your Rating
We found other products you might like!