- Gene Symbol:
- LCA5L
- NCBI Gene Id:
- 150082
- Official Gene Full Name:
- Leber congenital amaurosis 5-like
- Protein Name:
- Lebercilin-like protein
- Swissprot Id:
- O95447
- Protein Accession #:
- NP_689718
- Nucleotide Accession #:
- NM_152505
- Alias Symbols:
- MGC33295, C21orf13
- Replacement Item:
- This antibody may replace item sc-146668 from Santa Cruz Biotechnology.
- Description of Target:
- The function of the C21orf13 protein remains unknown.
- Protein Size (# AA):
- 670
- Molecular Weight:
- 76kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express C21orf13.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express C21orf13.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf13
- Tested Species Reactivity:
- Human, Mouse
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Yeast: 75%
- Complete computational species homology data:
- Anti-C21orf13 (ARP45912_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- TFIP11; NMI; TPM3; SUV39H2;
- Blocking Peptide:
- For anti-LCA5L (ARP45912_P050) antibody is Catalog # AAP45912 (Previous Catalog # AAPS16510)
- Datasheets/Manuals:
- Printable datasheet for anti-LCA5L (ARP45912_P050) antibody
- Target Reference:
- den (2007) Nat. Genet. 39 (7), 889-895
- Publications:
Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Human, Yeast 23103828
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
