Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45911_P050-FITC Conjugated

ARP45911_P050-HRP Conjugated

ARP45911_P050-Biotin Conjugated

C21orf13 Antibody - middle region (ARP45911_P050)

Catalog#: ARP45911_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Horse, Human, Pig
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-146668 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C21orf13
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Horse: 86%; Human: 100%; Pig: 93%
Complete computational species homology data Anti-C21orf13 (ARP45911_P050)
Peptide Sequence Synthetic peptide located within the following region: GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSSPTEGKRKIII
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LCA5L (ARP45911_P050) antibody is Catalog # AAP45911 (Previous Catalog # AAPS16509)
Datasheets/Manuals Printable datasheet for anti-LCA5L (ARP45911_P050) antibody
Target Reference den (2007) Nat. Genet. 39 (7), 889-895
Gene Symbol LCA5L
Official Gene Full Name Leber congenital amaurosis 5-like
Alias Symbols MGC33295, C21orf13
NCBI Gene Id 150082
Protein Name Lebercilin-like protein
Description of Target The function of the C21orf13 protein remains unknown.
Swissprot Id O95447
Protein Accession # NP_689718
Nucleotide Accession # NM_152505
Protein Size (# AA) 670
Molecular Weight 76kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express C21orf13.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express C21orf13.
Protein Interactions TFIP11; NMI; TPM3; SUV39H2;
Write Your Own Review
You're reviewing:C21orf13 Antibody - middle region (ARP45911_P050)
Your Rating