Search Antibody, Protein, and ELISA Kit Solutions

C21orf13 Antibody - middle region (ARP45911_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45911_P050-FITC Conjugated

ARP45911_P050-HRP Conjugated

ARP45911_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Horse, Human, Pig
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Leber congenital amaurosis 5-like
NCBI Gene Id:
Protein Name:
Lebercilin-like protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC33295, C21orf13
Replacement Item:
This antibody may replace item sc-146668 from Santa Cruz Biotechnology.
Description of Target:
The function of the C21orf13 protein remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C21orf13.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C21orf13.
The immunogen is a synthetic peptide directed towards the middle region of human C21orf13
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Horse: 86%; Human: 100%; Pig: 93%
Complete computational species homology data:
Anti-C21orf13 (ARP45911_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSSPTEGKRKIII
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-LCA5L (ARP45911_P050) antibody is Catalog # AAP45911 (Previous Catalog # AAPS16509)
Printable datasheet for anti-LCA5L (ARP45911_P050) antibody
Target Reference:
den (2007) Nat. Genet. 39 (7), 889-895

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...