Catalog No: ARP52520_P050
Price: $0.00
SKU
ARP52520_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

C20orf141 Antibody - middle region (ARP52520_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-C20orf141 (ARP52520_P050) antibody
Product Info
ReferenceDeloukas,P., (2001) Nature 414 (6866), 865-871
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C20orf141
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: RKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMGLGPLL
Concentration0.5 mg/ml
Blocking PeptideFor anti-C20orf141 (ARP52520_P050) antibody is Catalog # AAP52520 (Previous Catalog # AAPP30433)
Gene SymbolC20orf141
Gene Full NameChromosome 20 open reading frame 141
Alias SymbolsdJ860F19.4
NCBI Gene Id128653
Protein NameUncharacterized protein C20orf141
Description of TargetC20orf141 is a single-pass membrane protein. The exact function of C20orf141 remains unknown.
Uniprot IDQ9NUB4
Protein Accession #NP_542777
Nucleotide Accession #NM_080739
Protein Size (# AA)165
Molecular Weight17kDa
  1. What is the species homology for "C20orf141 Antibody - middle region (ARP52520_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "C20orf141 Antibody - middle region (ARP52520_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "C20orf141 Antibody - middle region (ARP52520_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "C20orf141 Antibody - middle region (ARP52520_P050)"?

    This target may also be called "dJ860F19.4" in publications.

  5. What is the shipping cost for "C20orf141 Antibody - middle region (ARP52520_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "C20orf141 Antibody - middle region (ARP52520_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C20orf141 Antibody - middle region (ARP52520_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "17kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C20orf141 Antibody - middle region (ARP52520_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "C20ORF141"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "C20ORF141"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "C20ORF141"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "C20ORF141"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "C20ORF141"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "C20ORF141"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:C20orf141 Antibody - middle region (ARP52520_P050)
Your Rating