Search Antibody, Protein, and ELISA Kit Solutions

C2 Antibody - middle region (ARP79173_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
C2
Official Gene Full Name:
complement component 2
NCBI Gene Id:
717
Protein Name:
complement C2
Swissprot Id:
A0A0G2JK28
Protein Accession #:
NP_000054.2
Alias Symbols:
CO2, ARMD14
Replacement Item:
This antibody may replace item sc-114242 from Santa Cruz Biotechnology.
Description of Target:
Component C2 is a serum glycoprotein that functions as part of the classical pathway of the complement system. Activated C1 cleaves C2 into C2a and C2b. The serine proteinase C2a then combines with complement factor 4b to create the C3 or C5 convertase. Deficiency of C2 has been reported to associated with certain autoimmune diseases and SNPs in this gene have been associated with altered susceptibility to age-related macular degeneration. This gene localizes within the class III region of the MHC on the short arm of chromosome 6. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described in publications but their full-length sequence has not been determined.
Protein Size (# AA):
353
Molecular Weight:
38 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human C2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: FILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPWHVTIKP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-C2 (ARP79173_P050) antibody is Catalog # AAP79173
Datasheets/Manuals:
Printable datasheet for anti-C2 (ARP79173_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...