Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP79173_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

C2 Antibody - middle region (ARP79173_P050)

Catalog#: ARP79173_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-114242 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C2
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: FILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPWHVTIKP
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-C2 (ARP79173_P050) antibody is Catalog # AAP79173
Datasheets/ManualsPrintable datasheet for anti-C2 (ARP79173_P050) antibody
Gene SymbolC2
Official Gene Full Namecomplement component 2
Alias SymbolsCO2, ARMD14
NCBI Gene Id717
Protein Namecomplement C2
Description of TargetComponent C2 is a serum glycoprotein that functions as part of the classical pathway of the complement system. Activated C1 cleaves C2 into C2a and C2b. The serine proteinase C2a then combines with complement factor 4b to create the C3 or C5 convertase. Deficiency of C2 has been reported to associated with certain autoimmune diseases and SNPs in this gene have been associated with altered susceptibility to age-related macular degeneration. This gene localizes within the class III region of the MHC on the short arm of chromosome 6. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described in publications but their full-length sequence has not been determined.
Swissprot IdA0A0G2JK28
Protein Accession #NP_000054.2
Protein Size (# AA)353
Molecular Weight38 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express C2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express C2.
Write Your Own Review
You're reviewing:C2 Antibody - middle region (ARP79173_P050)
Your Rating
Aviva Tips and Tricks
Aviva HIS tag Deal
Assay Development
Free Microscope